KEGG   Homo sapiens (human): 1977Help
Entry
1977              CDS       T01001                                 

Gene name
EIF4E, AUTS19, CBP, EIF4E1, EIF4EL1, EIF4F
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1977 (EIF4E)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    1977 (EIF4E)
   04151 PI3K-Akt signaling pathway
    1977 (EIF4E)
   04150 mTOR signaling pathway
    1977 (EIF4E)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    1977 (EIF4E)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    1977 (EIF4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q21-q25
AA seq 237 aa AA seqDB search
MLDLTSRGQVGTSRRMAEAACSAHFLETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQ
NRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEP
MWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKG
DKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgttggacctgacctcccgcggacaagtggggacgtcccggaggatggccgaggcggcg
tgtagcgcacactttctggaaaccacccctactcctaatcccccgactacagaagaggag
aaaacggaatctaatcaggaggttgctaacccagaacactatattaaacatcccctacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctg
cggctgatctccaagtttgatactgttgaagacttttgggctctgtacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacggggaggacgatggctaattacattgaacaaacag
cagagacgaagtgacctcgatcgcttttggctagagacacttctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggcgctgttgttaatgttagagctaaaggt
gataagatagcaatatggactactgaatgtgaaaacagagaagctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccac
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system