KEGG   Homo sapiens (human): 1981Help
Entry
1981              CDS       T01001                                 

Gene name
EIF4G1, EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18
Definition
eukaryotic translation initiation factor 4 gamma, 1
Orthology
K03260  
translation initiation factor 4G
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Viral myocarditis
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    1981 (EIF4G1)
 Human Diseases
  Cardiovascular diseases
   05416 Viral myocarditis
    1981 (EIF4G1)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    1981 (EIF4G1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q27.1
AA seq 1606 aa AA seqDB search
MNKAPQSTGPPPAPSPGLPQPAFPPGQTAPVVFSTPQATQMNTPSQPRQGGFRSLQHFYP
SRAQPPSSAASRVQSAAPARPGPAAHVYPAGSQVMMIPSQISYPASQGAYYIPGQGRSTY
VVPTQQYPVQPGAPGFYPGASPTEFGTYAGAYYPAQGVQQFPTGVAPAPVLMNQPPQIAP
KRERKTIRIRDPNQGGKDITEEIMSGARTASTPTPPQTGGGLEPQANGETPQVAVIVRPD
DRSQGAIIADRPGLPGPEHSPSESQPSSPSPTPSPSPVLEPGSEPNLAVLSIPGDTMTTI
QMSVEESTPISRETGEPYRLSPEPTPLAEPILEVEVTLSKPVPESEFSSSPLQAPTPLAS
HTVEIHEPNGMVPSEDLEPEVESSPELAPPPACPSESPVPIAPTAQPEELLNGAPSPPAV
DLSPVSEPEEQAKEVTASMAPPTIPSATPATAPSATSPAQEEEMEEEEEEEEGEAGEAGE
AESEKGGEELLPPESTPIPANLSQNLEAAAATQVAVSVPKRRRKIKELNKKEAVGDLLDA
FKEANPAVPEVENQPPAGSNPGPESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQK
YEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANKTPLRPLD
PTRLQGINCGPDFTPSFANLGRTTLSTRGPPRGGPGGELPRGPAGLGPRRSQQGPRKEPR
KIIATVLMTEDIKLNKAEKAWKPSSKRTAADKDRGEEDADGSKTQDLFRRVRSILNKLTP
QMFQQLMKQVTQLAIDTEERLKGVIDLIFEKAISEPNFSVAYANMCRCLMALKVPTTEKP
TVTVNFRKLLLNRCQKEFEKDKDDDEVFEKKQKEMDEAATAEERGRLKEELEEARDIARR
RSLGNIKFIGELFKLKMLTEAIMHDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKP
RMDQYFNQMEKIIKEKKTSSRIRFMLQDVLDLRGSNWVPRRGDQGPKTIDQIHKEAEMEE
HREHIKVQQLMAKGSDKRRGGPPGPPISRGLPLVDDGGWNTVPISKGSRPIDTSRLTKIT
KPGSIDSNNQLFAPGGRLSWGKGSSGGSGAKPSDAASEAARPATSTLNRFSALQQAVPTE
STDNRRVVQRSSLSRERGEKAGDRGDRLERSERGGDRGDRLDRARTPATKRSFSKEVEER
SRERPSQPEGLRKAASLTEDRDRGRDAVKREAALPPVSPLKAALSEEELEKKSKAIIEEY
LHLNDMKEAVQCVQELASPSLLFIFVRHGVESTLERSAIAREHMGQLLHQLLCAGHLSTA
QYYQGLYEILELAEDMEIDIPHVWLYLAELVTPILQEGGVPMGELFREITKPLRPLGKAA
SLLLEILGLLCKSMGPKKVGTLWREAGLSWKEFLPEGQDIGAFVAEQKVEYTLGEESEAP
GQRALPSEELNRQLEKLLKEGSSNQRVFDWIEANLSEQQIVSNTLVRALMTAVCYSAIIF
ETPLRVDVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDED
VVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
NT seq 4821 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagctccacagtccacaggccccccacccgccccatcccccggactcccacag
ccagcgtttcccccggggcagacagcgccggtggtgttcagtacgccacaagcgacacaa
atgaacacgccttctcagccccgccagggaggattcaggtctctgcagcacttctaccct
agccgggcccagcccccgagcagtgcagcctcccgagtgcagagtgcagcccctgcccgc
cctggcccagctgcccatgtctaccctgctggatcccaagtaatgatgatcccttcccag
atctcctacccagcctcccagggggcctactacatccctggacaggggcgttccacatac
gttgtcccgacacagcagtaccctgtgcagccaggagccccaggcttctatccaggtgca
agccctacagaatttgggacctacgctggcgcctactatccagcccaaggggtgcagcag
tttcccactggcgtggcccccgccccagttttgatgaaccagccaccccagattgctccc
aagagggagcgtaagacgatccgaattcgagatccaaaccaaggaggaaaggatatcaca
gaggagatcatgtctggggcccgcactgcctccacacccacccctccccagacgggaggc
ggtctggagcctcaagctaatggggagacgccccaggttgctgtcattgtccggccagat
gaccggtcacagggagcaatcattgctgaccggccagggctgcctggcccagagcatagc
ccttcagaatcccagccttcgtcgccttctccgaccccatcaccatccccagtcttggaa
ccggggtctgagcctaatctcgcagtcctctctattcctggggacactatgacaactata
caaatgtctgtagaagaatcaacccccatctcccgtgaaactggggagccatatcgcctc
tctccagaacccactcctctcgccgaacccatactggaagtagaagtgacacttagcaaa
ccggttccagaatctgagttttcttccagtcctctccaggctcccacccctttggcatct
cacacagtggaaattcatgagcctaatggcatggtcccatctgaagatctggaaccagag
gtggagtcaagcccagagcttgctcctcccccagcttgcccctccgaatcccctgtgccc
attgctccaactgcccaacctgaggaactgctcaacggagccccctcgccaccagctgtg
gacttaagcccagtcagtgagccagaggagcaggccaaggaggtgacagcatcaatggcg
ccccccaccatcccctctgctactccagctacggctccttcagctacttccccagctcag
gaggaggaaatggaagaagaagaagaagaggaagaaggagaagcaggagaagcaggagaa
gctgagagtgagaaaggaggagaggaactgctccccccagagagtacccctattccagcc
aacttgtctcagaatttggaggcagcagcagccactcaagtggcagtatctgtgccaaag
aggagacggaaaattaaggagctaaataagaaggaggctgttggagaccttctggatgcc
ttcaaggaggcgaacccggcagtaccagaggtggaaaatcagcctcctgcaggcagcaat
ccaggcccagagtctgagggcagtggtgtgcccccacgtcctgaggaagcagatgagacc
tgggactcaaaggaagacaaaattcacaatgctgagaacatccagcccggggaacagaag
tatgaatataagtcagatcagtggaagcctctaaacctagaggagaaaaaacgttacgac
cgtgagttcctgcttggttttcagttcatctttgccagtatgcagaagccagagggattg
ccacatatcagtgacgtggtgctggacaaggccaataaaacaccactgcggccactggat
cccactagactacaaggcataaattgtggcccagacttcactccatcctttgccaacctt
ggccggacaacccttagcacccgtgggcccccaaggggtgggccaggtggggagctgccc
cgtgggccggctggcctgggaccccggcgctctcagcagggaccccgaaaagaaccacgc
aagatcattgccacagtgttaatgaccgaagatataaaactgaacaaagcagagaaagcc
tggaaacccagcagcaagcggacggcggctgataaggatcgaggggaagaagatgctgat
ggcagcaaaacccaggacctattccgcagggtgcgctccatcctgaataaactgacaccc
cagatgttccagcagctgatgaagcaagtgacgcagctggccatcgacaccgaggaacgc
ctcaaaggggtcattgacctcatttttgagaaggccatttcagagcccaacttctctgtg
gcctatgccaacatgtgccgctgcctcatggcgctgaaagtgcccactacggaaaagcca
acagtgactgtgaacttccgaaagctgttgttgaatcgatgtcagaaggagtttgagaaa
gacaaagatgatgatgaggtttttgagaagaagcaaaaagagatggatgaagctgctacg
gcagaggaacgaggacgcctgaaggaagagctggaagaggctcgggacatagcccggcgg
cgctctttagggaatatcaagtttattggagagttgttcaaactgaagatgttaacagag
gcaataatgcatgactgtgtggtcaaactgcttaagaaccatgatgaagagtcccttgag
tgcctttgtcgtctgctcaccaccattggcaaagacctggactttgaaaaagccaagccc
cgaatggatcagtatttcaaccagatggaaaaaatcattaaagaaaagaagacgtcatcc
cgcatccgctttatgctgcaggacgtgctggatctgcgagggagcaattgggtgccacgc
cgaggggatcagggtcccaagaccattgaccagatccataaggaggctgagatggaagaa
catcgagagcacatcaaagtgcagcagctcatggccaagggcagtgacaagcgtcggggc
ggtcctccaggccctcccatcagccgtggacttccccttgtggatgatggtggctggaac
acagttcccatcagcaaaggtagccgccccattgacacctcacgactcaccaagatcacc
aagcctggctccatcgattctaacaaccagctctttgcacctggagggcgactgagctgg
ggcaagggcagcagcggaggctcaggagccaagccctcagacgcagcatcagaagctgct
cgcccagctactagtactttgaatcgcttctcagcccttcaacaagcggtacccacagaa
agcacagataatagacgtgtggtgcagaggagtagcttgagccgagaacgaggcgagaaa
gctggagaccgaggagaccgcctagagcggagtgaacggggaggggaccgtggggaccgg
cttgatcgtgcgcggacacctgctaccaagcggagcttcagcaaggaagtggaggagcgg
agtagagaacggccctcccagcctgaggggctgcgcaaggcagctagcctcacggaggat
cgggaccgtgggcgggatgccgtgaagcgagaagctgccctacccccagtgagccccctg
aaggcggctctctctgaggaggagttagagaagaaatccaaggctatcattgaggaatat
ctccatctcaatgacatgaaagaggcagtccagtgcgtgcaggagctggcctcaccctcc
ttgctcttcatctttgtacggcatggtgtcgagtctacgctggagcgcagtgccattgct
cgtgagcatatggggcagctgctgcaccagctgctctgtgctgggcatctgtctactgct
cagtactaccaagggttgtatgaaatcttggaattggctgaggacatggaaattgacatc
ccccacgtgtggctctacctagcggaactggtaacacccattctgcaggaaggtggggtg
cccatgggggagctgttcagggagattacaaagcctctgagaccgttgggcaaagctgct
tccctgttgctggagatcctgggcctcctgtgcaaaagcatgggtcctaaaaaggtgggg
acgctgtggcgagaagccgggcttagctggaaggaatttctacctgaaggccaggacatt
ggtgcattcgtcgctgaacagaaggtggagtataccctgggagaggagtcggaagcccct
ggccagagggcactcccctccgaggagctgaacaggcagctggagaagctgctgaaggag
ggcagcagtaaccagcgggtgttcgactggatagaggccaacctgagtgagcagcagata
gtatccaacacgttagttcgagccctcatgacggctgtctgctattctgcaattattttt
gagactcccctccgagtggacgttgcagtgctgaaagcgcgagcgaagctgctgcagaaa
tacctgtgtgacgagcagaaggagctacaggcgctctacgccctccaggcccttgtagtg
accttagaacagcctcccaacctgctgcggatgttctttgacgcactgtatgacgaggac
gtggtgaaggaggatgccttctacagttgggagagtagcaaggaccccgctgagcagcag
ggcaagggtgtggcccttaaatctgtcacagccttcttcaagtggctccgtgaagcagag
gaggagtctgaccacaactga

DBGET integrated database retrieval system