KEGG   Homo sapiens (human): 1991Help
Entry
1991              CDS       T01001                                 

Gene name
ELANE, ELA2, GE, HLE, HNE, NE, PMN-E, SCN1
Definition
elastase, neutrophil expressed (EC:3.4.21.37)
Orthology
K01327  
leukocyte elastase [EC:3.4.21.37]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Disease
H00100  
Neutropenic disorders
Drug target
Class
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:hsa05322]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 267 aa AA seqDB search
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcggccgccgactcgcgtgtcttttcctcgcctgtgtcctgccggccttgctg
ctggggggcaccgcgctggcctcggagattgtggggggccggcgagcgcggccccacgcg
tggcccttcatggtgtccctgcagctgcgcggaggccacttctgcggcgccaccctgatt
gcgcccaacttcgtcatgtcggccgcgcactgcgtggcgaatgtaaacgtccgcgcggtg
cgggtggtcctgggagcccataacctctcgcggcgggagcccacccggcaggtgttcgcc
gtgcagcgcatcttcgaaaacggctacgaccccgtaaacttgctcaacgacatcgtgatt
ctccagctcaacgggtcggccaccatcaacgccaacgtgcaggtggcccagctgccggct
cagggacgccgcctgggcaacggggtgcagtgcctggccatgggctggggccttctgggc
aggaaccgtgggatcgccagcgtcctgcaggagctcaacgtgacggtggtgacgtccctc
tgccgtcgcagcaacgtctgcactctcgtgaggggccggcaggccggcgtctgtttcggg
gactccggcagccccttggtctgcaacgggctaatccacggaattgcctccttcgtccgg
ggaggctgcgcctcagggctctaccccgatgcctttgccccggtggcacagtttgtaaac
tggatcgactctatcatccaacgctccgaggacaacccctgtccccacccccgggacccg
gacccggccagcaggacccactga

DBGET integrated database retrieval system