KEGG   Homo sapiens (human): 1991Help
Entry
1991              CDS       T01001                                 

Gene name
ELANE, ELA2, GE, HLE, HNE, NE, PMN-E, SCN1
Definition
elastase, neutrophil expressed (EC:3.4.21.37)
Orthology
K01327  
leukocyte elastase [EC:3.4.21.37]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Disease
H00100  
Neutropenic disorders
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    1991 (ELANE)
  Immune diseases
   05322 Systemic lupus erythematosus
    1991 (ELANE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.37  leukocyte elastase
     1991 (ELANE)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1991 (ELANE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1991 (ELANE)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Enzymes (General comment) Variety
  1991 (ELANE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 267 aa AA seqDB search
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcggccgccgactcgcgtgtcttttcctcgcctgtgtcctgccggccttgctg
ctggggggcaccgcgctggcctcggagattgtggggggccggcgagcgcggccccacgcg
tggcccttcatggtgtccctgcagctgcgcggaggccacttctgcggcgccaccctgatt
gcgcccaacttcgtcatgtcggccgcgcactgcgtggcgaatgtaaacgtccgcgcggtg
cgggtggtcctgggagcccataacctctcgcggcgggagcccacccggcaggtgttcgcc
gtgcagcgcatcttcgaaaacggctacgaccccgtaaacttgctcaacgacatcgtgatt
ctccagctcaacgggtcggccaccatcaacgccaacgtgcaggtggcccagctgccggct
cagggacgccgcctgggcaacggggtgcagtgcctggccatgggctggggccttctgggc
aggaaccgtgggatcgccagcgtcctgcaggagctcaacgtgacggtggtgacgtccctc
tgccgtcgcagcaacgtctgcactctcgtgaggggccggcaggccggcgtctgtttcggg
gactccggcagccccttggtctgcaacgggctaatccacggaattgcctccttcgtccgg
ggaggctgcgcctcagggctctaccccgatgcctttgccccggtggcacagtttgtaaac
tggatcgactctatcatccaacgctccgaggacaacccctgtccccacccccgggacccg
gacccggccagcaggacccactga

DBGET integrated database retrieval system