KEGG   Homo sapiens (human): 2002Help
Entry
2002              CDS       T01001                                 

Gene name
ELK1
Definition
ELK1, member of ETS oncogene family
Orthology
K04375  
ETS domain-containing protein Elk-1
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Focal adhesion
Insulin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
Prion diseases
Leishmaniasis
Hepatitis B
HTLV-I infection
Proteoglycans in cancer
Endometrial cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2002 (ELK1)
   04010 MAPK signaling pathway
    2002 (ELK1)
   04012 ErbB signaling pathway
    2002 (ELK1)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    2002 (ELK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2002 (ELK1)
   04912 GnRH signaling pathway
    2002 (ELK1)
   04921 Oxytocin signaling pathway
    2002 (ELK1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2002 (ELK1)
   05213 Endometrial cancer
    2002 (ELK1)
  Neurodegenerative diseases
   05020 Prion diseases
    2002 (ELK1)
  Infectious diseases
   05166 HTLV-I infection
    2002 (ELK1)
   05161 Hepatitis B
    2002 (ELK1)
   05140 Leishmaniasis
    2002 (ELK1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2002 (ELK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.2
AA seq 428 aa AA seqDB search
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH
AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacttcacgggatggtggtgaattcaagctggtggatgcagag
gaggtggcccggctgtgggggctacgcaagaacaagaccaacatgaattacgacaagctc
agccgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
ttcgtctacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggactgcccg
ccccagccagaggtgtctgttacctccaccatgccaaatgtggcccctgctgctatacat
gccgccccaggggacactgtctctggaaagccaggcacacccaagggtgcaggaatggca
ggcccaggcggtttggcacgcagcagccggaacgagtacatgcgctcgggcctctattcc
accttcaccatccagtctctgcagccgcagccaccccctcatcctcggcctgctgtggtg
ctccccagtgcagctcctgcaggggcagcagcgcccccctcggggagcaggagcaccagt
ccaagccccttggaggcctgtctggaggctgaagaggccggcttgcctctgcaggtcatc
ctgaccccgcccgaggccccaaacctgaaatcggaagagcttaatgtggagccgggtttg
ggccgggctttgcccccagaagtgaaagtagaagggcccaaggaagagttggaagttgcg
ggggagagagggtttgtgccagaaaccaccaaggccgagccagaagtccctccacaggag
ggcgtgccagcccggctgcccgcggttgttatggacaccgcagggcaggcgggcggccat
gcggcttccagccctgagatctcccagccgcagaagggccggaagccccgggacctagag
cttccactcagcccgagcctgctaggtgggccgggacccgaacggaccccaggatcggga
agtggctccggcctccaggctccggggccggcgctgaccccatccctgcttcctacgcat
acattgaccccggtgctgctgacacccagctcgctgcctcctagcattcacttctggagc
accctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccatccagt
ggcagcgcccaggtgcacatcccttctatcagcgtggatggcctctcgacccccgtggtg
ctctccccagggccccagaagccatga

DBGET integrated database retrieval system