KEGG   Homo sapiens (human): 201562Help
Entry
201562            CDS       T01001                                 

Gene name
HACD2, PTPLB
Definition
(RefSeq) 3-hydroxyacyl-CoA dehydratase 2
  KO
K10703  
very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase [EC:4.2.1.134]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid elongation
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation, endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    201562 (HACD2)
  Lipid metabolism
   00062 Fatty acid elongation
    201562 (HACD2)
   01040 Biosynthesis of unsaturated fatty acids
    201562 (HACD2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.134  very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase
     201562 (HACD2)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   201562 (HACD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q6Y1H2(Tbio)
UniProt: 
Position
3q21.1
AA seq 254 aa AA seqDB search
MAAVAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL
VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA
VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV
SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQR
RKILSHTEEHKKFE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagtggcggcgactgcagcagcgaaggggaatgggggcggcggtggcagggcc
ggggccggggacgccagcggcacgcggaagaagaagggcccggggcccctggccacggcg
tacctggtcatctacaatgtggtgatgacagccgggtggctggttatagcggttggtctg
gtccgagcatacctggctaagggtagctaccatagcctttattattcaattgaaaagcct
ttgaaattctttcaaactggagccttattggagattttacattgtgctataggaattgtt
ccatcttctgttgtcctgacttctttccaggtgatgtcaagagtttttctaatatgggca
gtaacacatagcgtcaaagaggtacagagtgaagacagtgtcctcctgtttgttattgca
tggacgatcacggaaatcatccgttactccttttatacattcagtctattaaaccatctg
ccttacctcatcaaatgggccaggtacacacttttcattgtgctgtacccaatgggagtg
tcaggagaactgctcacaatatatgcagctctgccctttgtcagacaagctggcctatat
tccatcagtttacccaacaaatacaatttctcttttgactactatgcattcctgattcta
ataatgatctcctacattccaatttttccccagttatacttccacatgatacaccagaga
agaaagatcctttctcatactgaagaacacaagaaatttgaatag

DBGET integrated database retrieval system