KEGG   Homo sapiens (human): 2017Help
Entry
2017              CDS       T01001                                 

Gene name
CTTN, EMS1
Definition
cortactin
Orthology
K06106  
cortactin
Organism
hsa  Homo sapiens (human)
Pathway
Tight junction
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell communication
   04530 Tight junction
    2017 (CTTN)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2017 (CTTN)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    2017 (CTTN)
   05131 Shigellosis
    2017 (CTTN)
   05100 Bacterial invasion of epithelial cells
    2017 (CTTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13
AA seq 634 aa AA seqDB search
MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKT
VPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARA
KTQTPPVSPAPQPTEERLPSSPVYEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREAS
SQQGLAYATEAVYESAEAPGHYPAEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDD
IITNIEMIDDGWWRGVCKGRFRELAFSCVRVALVPIKCSRDLPGQARGLRSALWRVGRKD
CPRRGASSRVSLLGRRGLGLMEVNPELSHPEHRSCHVRWEICLCHTVTARRIRKLISFLR
SREAGPVPSCSQVGGVSFQKVTWKCLGTWVPECP
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagcttcagcaggccacgctgtgtccatcgcccaggatgacgcgggggccgat
gactgggagaccgaccctgattttgtgaatgatgtgagtgagaaggagcaaagatggggt
gccaagacggtgcagggctccgggcaccaggagcatatcaacatacacaagctgagggag
aatgtctttcaagagcatcagacccttaaggagaaggaacttgaaacaggaccaaaagct
tcccatggctatggagggaaatttggtgtggaacaagaccgaatggataagtcagctgtc
ggccacgaatatcagtcgaaactttccaagcactgctcgcaggtggactcggtccgtggc
ttcggaggcaagtttggtgtccagatggacagagttgatcagtctgctgtaggctttgaa
taccaggggaagactgagaagcatgcctcccagaaagactactccagtggttttggcggc
aagtatggcgtgcaggccgaccgagtagacaagagcgcggtgggcttcgactaccagggc
aagacggagaagcacgagtcacagagagattactccaaaggtttcggcggcaaatacggt
atcgacaaggacaaagtggataagagcgccgttggctttgagtatcaaggcaaaacggag
aagcacgagtcccagaaagactatgtgaaagggtttggaggaaaatttggtgtgcagaca
gacagacaagacaaatgtgcccttggctgggatcaccaggagaaattgcagctgcatgaa
tcccaaaaagactactccaaaggattcggcgggaagtatggggtgcagaaggatcggatg
gataagaatgcgtcaacctttgaggatgtcacccaggtgtcctctgcctaccagaagaca
gtacctgtcgaagctgtgaccagcaaaacaagtaacatcagagctaactttgaaaacctc
gctaaggagaaagagcaggaggacaggcggaaggcggaggcggagagagcccagcggatg
gccaaggagcggcaggagcaggaagaggccaggaggaagctggaggagcaagccagagcc
aaaacgcaaacgccccctgtgtcgcccgcacctcagccaaccgaggagaggctgccctcg
agccccgtctatgaggatgcggcttccttcaaggcagagctgagctacagaggccctgtg
agtgggacggagccggagcccgtgtacagcatggaggccgctgactaccgagaggccagc
agccagcagggcctggcctatgccacagaggctgtctatgaaagcgcagaggccccgggc
cactatcccgcagaggacagcacctacgatgagtacgagaacgatctggggatcacagcc
gtcgccctgtacgactaccaggctgcgggcgatgatgagatctcatttgaccctgatgac
atcatcaccaacatcgagatgattgacgacggctggtggcgcggggtgtgcaagggccgc
ttcagggagctcgcattctcttgtgttcgtgttgccctcgtgcccatcaagtgcagtcgg
gacctcccaggacaagcacgaggcctcaggtcggccctgtggcgggtaggcaggaaggac
tgtcccagacgaggggcttcctctagagtctcactgctggggaggagaggactgggcctg
atggaagttaacccggagctaagtcacccagagcacaggagctgccatgtcagatgggaa
atctgcctatgtcataccgtgacagcccgcaggatcaggaaactcatctccttcctgagg
agccgggaggctggaccagtcccgtcgtgcagtcaggtgggcggtgtgtctttccagaag
gtcacgtggaaatgtctcgggacttgggtcccggagtgcccgtga

DBGET integrated database retrieval system