KEGG   Homo sapiens (human): 2017Help
Entry
2017              CDS       T01001                                 

Gene name
CTTN, EMS1
Definition
(RefSeq) cortactin
  KO
K06106  cortactin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    2017 (CTTN)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2017 (CTTN)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    2017 (CTTN)
   05131 Shigellosis
    2017 (CTTN)
   05100 Bacterial invasion of epithelial cells
    2017 (CTTN)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    2017 (CTTN)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    2017 (CTTN)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     2017 (CTTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HS1_rep SH3_9 SH3_1 SH3_2 FadA AMP-binding_C_2 MCU
Motif
Other DBs
NCBI-GeneID: 2017
NCBI-ProteinID: NP_005222
OMIM: 164765
HGNC: 3338
Ensembl: ENSG00000085733
Vega: OTTHUMG00000134307
Pharos: Q14247(Tbio)
UniProt: Q14247 Q53HG7
Structure
PDB: 

Jmol
Position
11q13.3
AA seq 550 aa AA seqDB search
MWKASAGHAVSIAQDDAGADDWETDPDFVNDVSEKEQRWGAKTVQGSGHQEHINIHKLRE
NVFQEHQTLKEKELETGPKASHGYGGKFGVEQDRMDKSAVGHEYQSKLSKHCSQVDSVRG
FGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFGGKYGVQADRVDKSAVGFDYQG
KTEKHESQRDYSKGFGGKYGIDKDKVDKSAVGFEYQGKTEKHESQKDYVKGFGGKFGVQT
DRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQ
DYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKE
KEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQTPPVSPAPQPTEERLPSSPV
YEDAASFKAELSYRGPVSGTEPEPVYSMEAADYREASSQQGLAYATEAVYESAEAPGHYP
AEDSTYDEYENDLGITAVALYDYQAAGDDEISFDPDDIITNIEMIDDGWWRGVCKGRYGL
FPANYVELRQ
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaagcttcagcaggccacgctgtgtccatcgcccaggatgacgcgggggccgat
gactgggagaccgaccctgattttgtgaatgatgtgagtgagaaggagcaaagatggggt
gccaagacggtgcagggctccgggcaccaggagcatatcaacatacacaagctgagggag
aatgtctttcaagagcatcagacccttaaggagaaggaacttgaaacaggaccaaaagct
tcccatggctatggagggaaatttggtgtggaacaagaccgaatggataagtcagctgtc
ggccacgaatatcagtcgaaactttccaagcactgctcgcaggtggactcggtccgtggc
ttcggaggcaagtttggtgtccagatggacagagttgatcagtctgctgtaggctttgaa
taccaggggaagactgagaagcatgcctcccagaaagactactccagtggttttggcggc
aagtatggcgtgcaggccgaccgagtagacaagagcgcggtgggcttcgactaccagggc
aagacggagaagcacgagtcacagagagattactccaaaggtttcggcggcaaatacggt
atcgacaaggacaaagtggataagagcgccgttggctttgagtatcaaggcaaaacggag
aagcacgagtcccagaaagactatgtgaaagggtttggaggaaaatttggtgtgcagaca
gacagacaagacaaatgtgcccttggctgggatcaccaggagaaattgcagctgcatgaa
tcccaaaaagattataagactggttttggaggcaaattcggtgttcagtcggagaggcag
gactccgctgctgtggggtttgattacaaggagaagctggccaagcacgagtcccagcaa
gactactccaaaggattcggcgggaagtatggggtgcagaaggatcggatggataagaat
gcgtcaacctttgaggatgtcacccaggtgtcctctgcctaccagaagacagtacctgtc
gaagctgtgaccagcaaaacaagtaacatcagagctaactttgaaaacctcgctaaggag
aaagagcaggaggacaggcggaaggcggaggcggagagagcccagcggatggccaaggag
cggcaggagcaggaagaggccaggaggaagctggaggagcaagccagagccaaaacgcaa
acgccccctgtgtcgcccgcacctcagccaaccgaggagaggctgccctcgagccccgtc
tatgaggatgcggcttccttcaaggcagagctgagctacagaggccctgtgagtgggacg
gagccggagcccgtgtacagcatggaggccgctgactaccgagaggccagcagccagcag
ggcctggcctatgccacagaggctgtctatgaaagcgcagaggccccgggccactatccc
gcagaggacagcacctacgatgagtacgagaacgatctggggatcacagccgtcgccctg
tacgactaccaggctgcgggcgatgatgagatctcatttgaccctgatgacatcatcacc
aacatcgagatgattgacgacggctggtggcgcggggtgtgcaagggccggtacgggctc
ttcccagccaactatgtggagctgcggcagtag

DBGET integrated database retrieval system