KEGG   Homo sapiens (human): 2021Help
Entry
2021              CDS       T01001                                 

Gene name
ENDOG
Definition
endonuclease G
Orthology
K01173  
endonuclease G, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    2021 (ENDOG)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    2021 (ENDOG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34.1
AA seq 297 aa AA seqDB search
MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRG
PGELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDS
VHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLE
KYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGG
QIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgctgcgggccggcctgaccctggcgtcgggcgcggggctgggtgcggtcgtc
gagggctggcggcggcggcgggaggacgcgcgggcggcgccgggactgctgggccggctg
cccgtgctgcccgtggcggcggcagccgagttgccccctgtgcccgggggaccccgcggc
ccgggcgagctggccaagtacgggctgccggggctggcgcagctcaagagccgcgagtcg
tacgtgctgtgctacgacccgcgcacccgcggcgcgctctgggtggtggagcagctgcga
cccgagcgtctccgcggcgacggcgaccggcgcgagtgcgacttccgcgaggacgactcg
gtgcacgcgtaccaccgtgccaccaacgccgactaccgcggcagtggcttcgaccgcggt
cacctggccgccgccgccaaccaccgctggagccagaaggccatggacgacacgttctac
ctgagcaacgtcgcgccccaggtgccccacctcaaccagaatgcctggaacaacctggag
aaatatagccgcagcttgacccgcagctaccaaaacgtctatgtctgcacagggccactc
ttcctgcccaggacagaggctgatgggaaatcctacgtaaagtaccaggtcatcggcaag
aaccacgtggcagtgcccacacacttcttcaaggtgctgatcctggaggcagcaggtggg
caaattgagctccgcacctacgtgatgcccaacgcacctgtggatgaggccatcccactg
gagcgcttcctggtgcccatcgagagcattgagcgggcttcggggctgctctttgtgcca
aacatcctggcgcgggcaggcagcctcaaggccatcacggcgggcagtaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system