KEGG   Homo sapiens (human): 2026Help
Entry
2026              CDS       T01001                                 

Gene name
ENO2, HEL-S-279, NSE
Definition
enolase 2 (gamma, neuronal) (EC:4.2.1.11)
Orthology
K01689  
enolase [EC:4.2.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
HIF-1 signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    2026 (ENO2)
   01230 Biosynthesis of amino acids
    2026 (ENO2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    2026 (ENO2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    2026 (ENO2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    2026 (ENO2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     2026 (ENO2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2026 (ENO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13
AA seq 434 aa AA seqDB search
MSIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGK
GVLKAVDHINSTIAPALISSGLSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCK
AGAAERELPLYRHIAQLAGNSDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGAESFRD
AMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKI
VIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDD
WAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLA
QENGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGDE
ARFAGHNFRNPSVL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagagaagatctgggcccgggagatcctggactcccgcgggaaccccacagtg
gaggtggatctctatactgccaaaggtcttttccgggctgcagtgcccagtggagcctct
acgggcatctatgaggccctggagctgagggatggagacaaacagcgttacttaggcaaa
ggtgtcctgaaggcagtggaccacatcaactccaccatcgcgccagccctcatcagctca
ggtctctctgtggtggagcaagagaaactggacaacctgatgctggagttggatgggact
gagaacaaatccaagtttggggccaatgccatcctgggtgtgtctctggccgtgtgtaag
gcaggggcagctgagcgggaactgcccctgtatcgccacattgctcagctggccgggaac
tcagacctcatcctgcctgtgccggccttcaacgtgatcaatggtggctctcatgctggc
aacaagctggccatgcaggagttcatgatcctcccagtgggagctgagagctttcgggat
gccatgcgactaggtgcagaggtctaccatacactcaagggagtcatcaaggacaaatac
ggcaaggatgccaccaatgtgggggatgaaggtggctttgcccccaatatcctggagaac
agtgaagccttggagctggtgaaggaagccatcgacaaggctggctacacggaaaagatc
gttattggcatggatgttgctgcctcagagttttatcgtgatggcaaatatgacttggac
ttcaagtctcccactgatccttcccgatacatcactggggaccagctgggggcactctac
caggactttgtcagggactatcctgtggtctccattgaggacccatttgaccaggatgat
tgggctgcctggtccaagttcacagccaatgtagggatccagattgtgggtgatgacctg
acagtgaccaacccaaaacgtattgagcgggcagtggaagaaaaggcctgcaactgtctg
ctgctcaaggtcaaccagatcggctcggtcactgaagccatccaagcgtgcaagctggcc
caggagaatggctggggggtcatggtgagtcatcgctcaggagagactgaggacacattc
attgctgacctggtggtggggctgtgcacaggccagatcaagactggtgccccgtgccgt
tctgaacgtctggctaaatacaaccagctcatgagaattgaggaagagctgggggatgaa
gctcgctttgccggacataacttccgtaatcccagtgtgctgtga

DBGET integrated database retrieval system