KEGG   Homo sapiens (human): 2033Help
Entry
2033              CDS       T01001                                 

Gene name
EP300, KAT3B, RSTS2, p300
Definition
(RefSeq) E1A binding protein p300 (EC:2.3.1.48)
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Glucagon signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Disease
H00504  
Rubinstein-Taybi syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    2033 (EP300)
   04330 Notch signaling pathway
    2033 (EP300)
   04350 TGF-beta signaling pathway
    2033 (EP300)
   04630 Jak-STAT signaling pathway
    2033 (EP300)
   04066 HIF-1 signaling pathway
    2033 (EP300)
   04068 FoxO signaling pathway
    2033 (EP300)
   04024 cAMP signaling pathway
    2033 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    2033 (EP300)
  Cellular commiunity
   04520 Adherens junction
    2033 (EP300)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    2033 (EP300)
   04919 Thyroid hormone signaling pathway
    2033 (EP300)
   04916 Melanogenesis
    2033 (EP300)
  Nervous system
   04720 Long-term potentiation
    2033 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2033 (EP300)
   05206 MicroRNAs in cancer
    2033 (EP300)
   05203 Viral carcinogenesis
    2033 (EP300)
   05211 Renal cell carcinoma
    2033 (EP300)
   05215 Prostate cancer
    2033 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    2033 (EP300)
  Infectious diseases
   05152 Tuberculosis
    2033 (EP300)
   05166 HTLV-I infection
    2033 (EP300)
   05164 Influenza A
    2033 (EP300)
   05161 Hepatitis B
    2033 (EP300)
   05168 Herpes simplex infection
    2033 (EP300)
   05169 Epstein-Barr virus infection
    2033 (EP300)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     2033 (EP300)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    2033 (EP300)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    2033 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q13.2
AA seq 2414 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINS
MVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAA
GNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQ
PLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMP
NMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGE
VRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNA
GDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQM
PTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQ
NPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAAL
KDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPN
AAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSM
AQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNI
PLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPS
LPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSST
EVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELK
TEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVD
PQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYK
YCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHF
CEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVL
HHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGE
VTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQE
YGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPP
SEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKE
LPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNK
SSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIP
CDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETR
WHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQ
SLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENK
CPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTG
QQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPG
PPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHL
EPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISP
LKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPI
PGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGG
MSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYP
PQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSP
QQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHV
SPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNS
DLNSNLSQSTLDIH
NT seq 7245 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctatttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attaatcagcttcagacaagtcttggcatggtacaagatgcagcttctaaacataaacag
ctgtcagaattgctgcgatctggtagttcccctaacctcaatatgggagttggtggccca
ggtcaagtcatggccagccaggcccaacagagcagtcctggattaggtttgataaatagc
atggtcaaaagcccaatgacacaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcctacgcagtcaacaggtatgatgaacagtccagtaaatcag
cctgccatgggaatgaacacagggatgaatgcgggcatgaatcctggaatgttggctgca
ggcaatggacaagggataatgcctaatcaagtcatgaacggttcaattggagcaggccga
gggcgacagaatatgcagtacccaaacccaggcatgggaagtgctggcaacttactgact
gagcctcttcagcagggctctccccagatgggaggacaaacaggattgagaggcccccag
cctcttaagatgggaatgatgaacaaccccaatccttatggttcaccatatactcagaat
cctggacagcagattggagccagtggccttggtctccagattcagacaaaaactgtacta
tcaaataacttatctccatttgctatggacaaaaaggcagttcctggtggaggaatgccc
aacatgggtcaacagccagccccgcaggtccagcagccaggcctggtgactccagttgcc
caagggatgggttctggagcacatacagctgatccagagaagcgcaagctcatccagcag
cagcttgttctccttttgcatgctcacaagtgccagcgccgggaacaggccaatggggaa
gtgaggcagtgcaaccttccccactgtcgcacaatgaagaatgtcctaaaccacatgaca
cactgccagtcaggcaagtcttgccaagtggcacactgtgcatcttctcgacaaatcatt
tcacactggaagaattgtacaagacatgattgtcctgtgtgtctccccctcaaaaatgct
ggtgataagagaaatcaacagccaattttgactggagcacccgttggacttggaaatcct
agctctctaggggtgggtcaacagtctgcccccaacctaagcactgttagtcagattgat
cccagctccatagaaagagcctatgcagctcttggactaccctatcaagtaaatcagatg
ccgacacaaccccaggtgcaagcaaagaaccagcagaatcagcagcctgggcagtctccc
caaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggtgta
ggagttcaaacgccgagtcttctttctgactcaatgttgcattcagccataaattctcaa
aacccaatgatgagtgaaaatgccagtgtgccctccctgggtcctatgccaacagcagct
caaccatccactactggaattcggaaacagtggcacgaagatattactcaggatcttcga
aatcatcttgttcacaaactcgtccaagccatatttcctacgccggatcctgctgcttta
aaagacagacggatggaaaacctagttgcatatgctcggaaagttgaaggggacatgtat
gaatctgcaaacaatcgagcggaatactaccaccttctagctgagaaaatctataagatc
cagaaagaactagaagaaaaacgaaggaccagactacagaagcagaacatgctaccaaat
gctgcaggcatggttccagtttccatgaatccagggcctaacatgggacagccgcaacca
ggaatgacttctaatggccctctacctgacccaagtatgatccgtggcagtgtgccaaac
cagatgatgcctcgaataactccacaatctggtttgaatcaatttggccagatgagcatg
gcccagccccctattgtaccccggcaaacccctcctcttcagcaccatggacagttggct
caacctggagctctcaacccgcctatgggctatgggcctcgtatgcaacagccttccaac
cagggccagttccttcctcagactcagttcccatcacagggaatgaatgtaacaaatatc
cctttggctccgtccagcggtcaagctccagtgtctcaagcacaaatgtctagttcttcc
tgcccggtgaactctcctataatgcctccagggtctcaggggagccacattcactgtccc
cagcttcctcaaccagctcttcatcagaattcaccctcgcctgtacctagtcgtaccccc
acccctcaccatactcccccaagcataggggctcagcagccaccagcaacaacaattcca
gcccctgttcctacacctcctgccatgccacctgggccacagtcccaggctctacatccc
cctccaaggcagacacctacaccaccaacaacacaacttccccaacaagtgcagccttca
cttcctgctgcaccttctgctgaccagccccagcagcagcctcgctcacagcagagcaca
gcagcgtctgttcctaccccaacagcaccgctgcttcctccgcagcctgcaactccactt
tcccagccagctgtaagcattgaaggacaggtatcaaatcctccatctactagtagcaca
gaagtgaattctcaggccattgctgagaagcagccttcccaggaagtgaagatggaggcc
aaaatggaagtggatcaaccagaaccagcagatactcagccggaggatatttcagagtct
aaagtggaagactgtaaaatggaatctaccgaaacagaagagagaagcactgagttaaaa
actgaaataaaagaggaggaagaccagccaagtacttcagctacccagtcatctccggct
ccaggacagtcaaagaaaaagattttcaaaccagaagaactacgacaggcactgatgcca
actttggaggcactttaccgtcaggatccagaatcccttccctttcgtcaacctgtggac
cctcagcttttaggaatccctgattactttgatattgtgaagagccccatggatctttct
accattaagaggaagttagacactggacagtatcaggagccctggcagtatgtcgatgat
atttggcttatgttcaataatgcctggttatataaccggaaaacatcacgggtatacaaa
tactgctccaagctctctgaggtctttgaacaagaaattgacccagtgatgcaaagcctt
ggatactgttgtggcagaaagttggagttctctccacagacactgtgttgctacggcaaa
cagttgtgcacaatacctcgtgatgccacttattacagttaccagaacaggtatcatttc
tgtgagaagtgtttcaatgagatccaaggggagagcgtttctttgggggatgacccttcc
cagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactggat
cctgaactgtttgttgaatgtacagagtgcggaagaaagatgcatcagatctgtgtcctt
caccatgagatcatctggcctgctggattcgtctgtgatggctgtttaaagaaaagtgca
cgaactaggaaagaaaataagttttctgctaaaaggttgccatctaccagacttggcacc
tttctagagaatcgtgtgaatgactttctgaggcgacagaatcaccctgagtcaggagag
gtcactgttagagtagttcatgcttctgacaaaaccgtggaagtaaaaccaggcatgaaa
gcaaggtttgtggacagtggagagatggcagaatcctttccataccgaaccaaagccctc
tttgcctttgaagaaattgatggtgttgacctgtgcttctttggcatgcatgttcaagag
tatggctctgactgccctccacccaaccagaggagagtatacatatcttacctcgatagt
gttcatttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctaattgga
tatttagaatatgtcaagaaattaggttacacaacagggcatatttgggcatgtccacca
agtgagggagatgattatatcttccattgccatcctcctgaccagaagatacccaagccc
aagcgactgcaggaatggtacaaaaaaatgcttgacaaggctgtatcagagcgtattgtc
catgactacaaggatatttttaaacaagctactgaagatagattaacaagtgcaaaggaa
ttgccttatttcgagggtgatttctggcccaatgttctggaagaaagcattaaggaactg
gaacaggaggaagaagagagaaaacgagaggaaaacaccagcaatgaaagcacagatgtg
accaagggagacagcaaaaatgctaaaaagaagaataataagaaaaccagcaaaaataag
agcagcctgagtaggggcaacaagaagaaacccgggatgcccaatgtatctaacgacctc
tcacagaaactatatgccaccatggagaagcataaagaggtcttctttgtgatccgcctc
attgctggccctgctgccaactccctgcctcccattgttgatcctgatcctctcatcccc
tgcgatctgatggatggtcgggatgcgtttctcacgctggcaagggacaagcacctggag
ttctcttcactccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacg
cagagccaggaccgctttgtctacacctgcaatgaatgcaagcaccatgtggagacacgc
tggcactgtactgtctgtgaggattatgacttgtgtatcacctgctataacactaaaaac
catgaccacaaaatggagaaactaggccttggcttagatgatgagagcaacaaccagcag
gctgcagccacccagagcccaggcgattctcgccgcctgagtatccagcgctgcatccag
tctctggtccatgcttgccagtgtcggaatgccaattgctcactgccatcctgccagaag
atgaagcgggttgtgcagcataccaagggttgcaaacggaaaaccaatggcgggtgcccc
atctgcaagcagctcattgccctctgctgctaccatgccaagcactgccaggagaacaaa
tgcccggtgccgttctgcctaaacatcaagcagaagctccggcagcaacagctgcagcac
cgactacagcaggcccaaatgcttcgcaggaggatggccagcatgcagcggactggtgtg
gttgggcagcaacagggcctcccttcccccactcctgccactccaacgacaccaactggc
caacagccaaccaccccgcagacgccccagcccacttctcagcctcagcctacccctccc
aatagcatgccaccctacttgcccaggactcaagctgctggccctgtgtcccagggtaag
gcagcaggccaggtgacccctccaacccctcctcagactgctcagccaccccttccaggg
cccccacctgcagcagtggaaatggcaatgcagattcagagagcagcggagacgcagcgc
cagatggcccacgtgcaaatttttcaaaggccaatccaacaccagatgcccccgatgact
cccatggcccccatgggtatgaacccacctcccatgaccagaggtcccagtgggcatttg
gagccagggatgggaccgacagggatgcagcaacagccaccctggagccaaggaggattg
cctcagccccagcaactacagtctgggatgccaaggccagccatgatgtcagtggcccag
catggtcaacctttgaacatggctccacaaccaggattgggccaggtaggtatcagccca
ctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggactctcaggtct
cccagctctcccctgcagcagcaacaggtgcttagtatccttcacgccaacccccagctg
ttggctgcattcatcaagcagcgggctgccaagtatgccaactctaatccacaacccatc
cctgggcagcctggcatgccccaggggcagccagggctacagccacctaccatgccaggt
cagcagggggtccactccaatccagccatgcagaacatgaatccaatgcaggcgggcgtt
cagagggctggcctgccccagcagcaaccacagcagcaactccagccacccatgggaggg
atgagcccccaggctcagcagatgaacatgaaccacaacaccatgccttcacaattccga
gacatcttgagacgacagcaaatgatgcaacagcagcagcaacagggagcagggccagga
ataggccctggaatggccaaccataaccagttccagcaaccccaaggagttggctaccca
ccacagcagcagcagcggatgcagcatcacatgcaacagatgcaacaaggaaatatggga
cagataggccagcttccccaggccttgggagcagaggcaggtgccagtctacaggcctat
cagcagcgactccttcagcaacagatggggtcccctgttcagcccaaccccatgagcccc
cagcagcatatgctcccaaatcaggcccagtccccacacctacaaggccagcagatccct
aattctctctccaatcaagtgcgctctccccagcctgtcccttctccacggccacagtcc
cagcccccccactccagtccttccccaaggatgcagcctcagccttctccacaccacgtt
tccccacagacaagttccccacatcctggactggtagctgcccaggccaaccccatggaa
caagggcattttgccagcccggaccagaattcaatgctttctcagcttgctagcaatcca
ggcatggcaaacctccatggtgcaagcgccacggacctgggactcagcaccgataactca
gacttgaattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system