KEGG   Homo sapiens (human): 2042Help
Entry
2042              CDS       T01001                                 

Gene name
EPHA3, EK4, ETK, ETK1, HEK, HEK4, TYRO4
Definition
(RefSeq) EPH receptor A3
  KO
K05104  Eph receptor A3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    2042 (EPHA3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2042 (EPHA3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2042 (EPHA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_2 SAM_1 Pur_ac_phosph_N Ephrin_rec_like fn3_2 TMEM154 Haspin_kinase Kdo SusE
Motif
Other DBs
NCBI-GeneID: 2042
NCBI-ProteinID: NP_005224
OMIM: 179611
HGNC: 3387
Ensembl: ENSG00000044524
Vega: OTTHUMG00000159040
Pharos: P29320(Tchem)
UniProt: P29320 A0A140VJJ0 Q6P4R6
Structure
PDB: 

Jmol
Position
3p11.1
AA seq 983 aa AA seqDB search
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKNGPVPV
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcagctctccatcctcctccttctcagctgctctgttctcgacagcttcggg
gaactgattccgcagccttccaatgaagtcaatctactggattcaaaaacaattcaaggg
gagctgggctggatctcttatccatcacatgggtgggaagagatcagtggtgtggatgaa
cattacacacccatcaggacttaccaggtgtgcaatgtcatggaccacagtcaaaacaat
tggctgagaacaaactgggtccccaggaactcagctcagaagatttatgtggagctcaag
ttcactctacgagactgcaatagcattccattggttttaggaacttgcaaggagacattc
aacctgtactacatggagtctgatgatgatcatggggtgaaatttcgagagcatcagttt
acaaagattgacaccattgcagctgatgaaagtttcactcaaatggatcttggggaccgt
attctgaagctcaacactgagattagagaagtaggtcctgtcaacaagaagggattttat
ttggcatttcaagatgttggtgcttgtgttgccttggtgtctgtgagagtatacttcaaa
aagtgcccatttacagtgaagaatctggctatgtttccagacacggtacccatggactcc
cagtccctggtggaggttagagggtcttgtgtcaacaattctaaggaggaagatcctcca
aggatgtactgcagtacagaaggcgaatggcttgtacccattggcaagtgttcctgcaat
gctggctatgaagaaagaggttttatgtgccaagcttgtcgaccaggtttctacaaggca
ttggatggtaatatgaagtgtgctaagtgcccgcctcacagttctactcaggaagatggt
tcaatgaactgcaggtgtgagaataattacttccgggcagacaaagaccctccatccatg
gcttgtacccgacctccatcttcaccaagaaatgttatctctaatataaacgagacctca
gttatcctggactggagttggcccctggacacaggaggccggaaagatgttaccttcaac
atcatatgtaaaaaatgtgggtggaatataaaacagtgtgagccatgcagcccaaatgtc
cgcttcctccctcgacagtttggactcaccaacaccacggtgacagtgacagaccttctg
gcacatactaactacacctttgagattgatgccgttaatggggtgtcagagctgagctcc
ccaccaagacagtttgctgcggtcagcatcacaactaatcaggctgctccatcacctgtc
ctgacgattaagaaagatcggacctccagaaatagcatctctttgtcctggcaagaacct
gaacatcctaatgggatcatattggactacgaggtcaaatactatgaaaagcaggaacaa
gaaacaagttataccattctgagggcaagaggcacaaatgttaccatcagtagcctcaag
cctgacactatatacgtattccaaatccgagcccgaacagccgctggatatgggacgaac
agccgcaagtttgagtttgaaactagtccagactctttctccatctctggtgaaagtagc
caagtggtcatgatcgccatttcagcggcagtagcaattattctcctcactgttgtcatc
tatgttttgattgggaggttctgtggctataagtcaaaacatggggcagatgaaaaaaga
cttcattttggcaatgggcatttaaaacttccaggtctcaggacttatgttgacccacat
acatatgaagaccctacccaagctgttcatgagtttgccaaggaattggatgccaccaac
atatccattgataaagttgttggagcaggtgaatttggagaggtgtgcagtggtcgctta
aaacttccttcaaaaaaagagatttcagtggccattaagaccctgaaagttggctacaca
gaaaagcagaggagagacttcctgggagaagcaagcattatgggacagtttgaccacccc
aatatcattcgactggaaggagttgttaccaaaagtaagccagttatgattgtcacagaa
tacatggagaatggttccttggatagtttcctacgtaaacacgatgcccagtttactgtc
attcagctagtggggatgcttcgagggatagcatctggcatgaagtacctgtcagacatg
ggctatgttcaccgagacctcgctgctcggaacatcttgatcaacagtaacttggtgtgt
aaggtttctgatttcggactttcgcgtgtcctggaggatgacccagaagctgcttataca
acaagaggagggaagatcccaatcaggtggacatcaccagaagctatagcctaccgcaag
ttcacgtcagccagcgatgtatggagttatgggattgttctctgggaggtgatgtcttat
ggagagagaccatactgggagatgtccaatcaggatgtaattaaagctgtagatgagggc
tatcgactgccaccccccatggactgcccagctgccttgtatcagctgatgctggactgc
tggcagaaagacaggaacaacagacccaagtttgagcagattgttagtattctggacaag
cttatccggaatcccggcagcctgaagatcatcaccagtgcagccgcaaggccatcaaac
cttcttctggaccaaagcaatgtggatatcactaccttccgcacaacaggtgactggctt
aatggtgtctggacagcacactgcaaggaaatcttcacgggtgtggagtacagttcttgt
gacacaatagccaagatttccacagatgacatgaaaaaggttggtgtcaccgtggttggg
ccacagaagaagatcatcagtagcattaaagctctagaaacgcaatcaaagaatggccca
gttcccgtgtaa

DBGET integrated database retrieval system