KEGG   Homo sapiens (human): 2042Help
Entry
2042              CDS       T01001                                 

Gene name
EPHA3, EK4, ETK, ETK1, HEK, HEK4, TYRO4
Definition
EPH receptor A3 (EC:2.7.10.1)
Orthology
K05104  
Eph receptor A3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Class
Organismal Systems; Development; Axon guidance [PATH:hsa04360]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p11.2
AA seq 983 aa AA seqDB search
MDCQLSILLLLSCSVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDG
SMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSS
PPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESS
QVVMIAISAAVAIILLTVVIYVLIGRFCGYKSKHGADEKRLHFGNGHLKLPGLRTYVDPH
TYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYT
EKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTV
IQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYT
TRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEG
YRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPSN
LLLDQSNVDITTFRTTGDWLNGVWTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVVG
PQKKIISSIKALETQSKNGPVPV
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggattgtcagctctccatcctcctccttctcagctgctctgttctcgacagcttcggg
gaactgattccgcagccttccaatgaagtcaatctactggattcaaaaacaattcaaggg
gagctgggctggatctcttatccatcacatgggtgggaagagatcagtggtgtggatgaa
cattacacacccatcaggacttaccaggtgtgcaatgtcatggaccacagtcaaaacaat
tggctgagaacaaactgggtccccaggaactcagctcagaagatttatgtggagctcaag
ttcactctacgagactgcaatagcattccattggttttaggaacttgcaaggagacattc
aacctgtactacatggagtctgatgatgatcatggggtgaaatttcgagagcatcagttt
acaaagattgacaccattgcagctgatgaaagtttcactcaaatggatcttggggaccgt
attctgaagctcaacactgagattagagaagtaggtcctgtcaacaagaagggattttat
ttggcatttcaagatgttggtgcttgtgttgccttggtgtctgtgagagtatacttcaaa
aagtgcccatttacagtgaagaatctggctatgtttccagacacggtacccatggactcc
cagtccctggtggaggttagagggtcttgtgtcaacaattctaaggaggaagatcctcca
aggatgtactgcagtacagaaggcgaatggcttgtacccattggcaagtgttcctgcaat
gctggctatgaagaaagaggttttatgtgccaagcttgtcgaccaggtttctacaaggca
ttggatggtaatatgaagtgtgctaagtgcccgcctcacagttctactcaggaagatggt
tcaatgaactgcaggtgtgagaataattacttccgggcagacaaagaccctccatccatg
gcttgtacccgacctccatcttcaccaagaaatgttatctctaatataaacgagacctca
gttatcctggactggagttggcccctggacacaggaggccggaaagatgttaccttcaac
atcatatgtaaaaaatgtgggtggaatataaaacagtgtgagccatgcagcccaaatgtc
cgcttcctccctcgacagtttggactcaccaacaccacggtgacagtgacagaccttctg
gcacatactaactacacctttgagattgatgccgttaatggggtgtcagagctgagctcc
ccaccaagacagtttgctgcggtcagcatcacaactaatcaggctgctccatcacctgtc
ctgacgattaagaaagatcggacctccagaaatagcatctctttgtcctggcaagaacct
gaacatcctaatgggatcatattggactacgaggtcaaatactatgaaaagcaggaacaa
gaaacaagttataccattctgagggcaagaggcacaaatgttaccatcagtagcctcaag
cctgacactatatacgtattccaaatccgagcccgaacagccgctggatatgggacgaac
agccgcaagtttgagtttgaaactagtccagactctttctccatctctggtgaaagtagc
caagtggtcatgatcgccatttcagcggcagtagcaattattctcctcactgttgtcatc
tatgttttgattgggaggttctgtggctataagtcaaaacatggggcagatgaaaaaaga
cttcattttggcaatgggcatttaaaacttccaggtctcaggacttatgttgacccacat
acatatgaagaccctacccaagctgttcatgagtttgccaaggaattggatgccaccaac
atatccattgataaagttgttggagcaggtgaatttggagaggtgtgcagtggtcgctta
aaacttccttcaaaaaaagagatttcagtggccattaagaccctgaaagttggctacaca
gaaaagcagaggagagacttcctgggagaagcaagcattatgggacagtttgaccacccc
aatatcattcgactggaaggagttgttaccaaaagtaagccagttatgattgtcacagaa
tacatggagaatggttccttggatagtttcctacgtaaacacgatgcccagtttactgtc
attcagctagtggggatgcttcgagggatagcatctggcatgaagtacctgtcagacatg
ggctatgttcaccgagacctcgctgctcggaacatcttgatcaacagtaacttggtgtgt
aaggtttctgatttcggactttcgcgtgtcctggaggatgacccagaagctgcttataca
acaagaggagggaagatcccaatcaggtggacatcaccagaagctatagcctaccgcaag
ttcacgtcagccagcgatgtatggagttatgggattgttctctgggaggtgatgtcttat
ggagagagaccatactgggagatgtccaatcaggatgtaattaaagctgtagatgagggc
tatcgactgccaccccccatggactgcccagctgccttgtatcagctgatgctggactgc
tggcagaaagacaggaacaacagacccaagtttgagcagattgttagtattctggacaag
cttatccggaatcccggcagcctgaagatcatcaccagtgcagccgcaaggccatcaaac
cttcttctggaccaaagcaatgtggatatcactaccttccgcacaacaggtgactggctt
aatggtgtctggacagcacactgcaaggaaatcttcacgggtgtggagtacagttcttgt
gacacaatagccaagatttccacagatgacatgaaaaaggttggtgtcaccgtggttggg
ccacagaagaagatcatcagtagcattaaagctctagaaacgcaatcaaagaatggccca
gttcccgtgtaa

DBGET integrated database retrieval system