KEGG   Homo sapiens (human): 2063Help
Entry
2063              CDS       T01001                                 

Gene name
NR2F6, EAR-2, EAR2, ERBAL2
Definition
(RefSeq) nuclear receptor subfamily 2 group F member 6
  KO
K08549  
nuclear receptor subfamily 2 group F member 6
Organism
hsa  Homo sapiens (human)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    2063 (NR2F6)
Nuclear receptors [BR:hsa03310]
 2. Hepatocyte nuclear factor 4 like
  2F. COUP-TF like receptor
   2063 (NR2F6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
19p13.1
AA seq 404 aa AA seqDB search
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCG
DKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVG
MRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYP
AAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWS
ELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSA
EYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPAL
RAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggccatggtgaccggcggctggggcggccccggcggcgacacgaacggcgtggacaag
gcgggcggctacccgcgcgcggccgaggacgactcggcctcgccccccggtgccgccagc
gacgccgagccgggcgacgaggagcggccggggctgcaggtggactgcgtggtgtgcggg
gacaagtcgagcggcaagcattacggtgtcttcacctgcgagggctgcaagagctttttc
aagcgaagcatccgccgcaacctcagctacacctgccggtccaaccgtgactgccagatc
gaccagcaccaccggaaccagtgccagtactgccgtctcaagaagtgcttccgggtgggc
atgaggaaggaggcggtgcagcgcggccgcatcccgcactcgctgcctggtgccgtggcc
gcctcctcgggcagccccccgggctcggcgctggcggcagtggcgagcggcggagacctc
ttcccggggcagccggtgtccgaactgatcgcgcagctgctgcgcgctgagccctaccct
gcggcggccggacgcttcggcgcagggggcggcgcggcgggcgcggtgctgggcatcgac
aacgtgtgcgagctggcggcgcggctgctcttcagcaccgtggagtgggcgcgccacgcg
cccttcttccccgagctgccggtggccgaccaggtggcgctgctgcgcctgagctggagc
gagctcttcgtgctgaacgcggcgcaggcggcgctgcccctgcacacggcgccgctactg
gccgccgccggcctccacgccgcgcctatggccgccgagcgcgccgtggctttcatggac
caggtgcgcgccttccaggagcaggtggacaagctgggccgcctgcaggtcgactcggcc
gagtatggctgcctcaaggccatcgcgctcttcacgcccgacgcctgtggcctctcagac
ccggcccacgttgagagcctgcaggagaaggcgcaggtggccctcaccgagtatgtgcgg
gcgcagtacccgtcccagccccagcgcttcgggcgcctgctgctgcggctccccgccctg
cgcgcggtccctgcctccctcatctcccagctgttcttcatgcgcctggtggggaagacg
cccattgagacactgatcagagacatgctgctgtcggggagtaccttcaactggccctac
ggctcgggccagtga

DBGET integrated database retrieval system