KEGG   Homo sapiens (human): 2066Help
Entry
2066              CDS       T01001                                 

Gene name
ERBB4, ALS19, HER4, p180erbB4
Definition
v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4 (EC:2.7.10.1)
Orthology
K05085  
receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Calcium signaling pathway
Endocytosis
Proteoglycans in cancer
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    2066 (ERBB4)
   04020 Calcium signaling pathway
    2066 (ERBB4)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2066 (ERBB4)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2066 (ERBB4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2066 (ERBB4)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  EGFR family [OT]
   2066 (ERBB4)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class I (EGF receptor family)
   2066 (ERBB4)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class I (EGF receptor family)
   2066 (ERBB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q33.3-q34
AA seq 1292 aa AA seqDB search
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQG
ATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRD
KPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTL
GKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP
IVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggcgacaggactttgggtctgggtgagccttctcgtggcggcggggaccgtc
cagcccagcgattctcagtcagtgtgtgcaggaacggagaataaactgagctctctctct
gacctggaacagcagtaccgagccttgcgcaagtactatgaaaactgtgaggttgtcatg
ggcaacctggagataaccagcattgagcacaaccgggacctctccttcctgcggtctgtt
cgagaagtcacaggctacgtgttagtggctcttaatcagtttcgttacctgcctctggag
aatttacgcattattcgtgggacaaaactttatgaggatcgatatgccttggcaatattt
ttaaactacagaaaagatggaaactttggacttcaagaacttggattaaagaacttgaca
gaaatcctaaatggtggagtctatgtagaccagaacaaattcctttgttatgcagacacc
attcattggcaagatattgttcggaacccatggccttccaacttgactcttgtgtcaaca
aatggtagttcaggatgtggacgttgccataagtcctgtactggccgttgctggggaccc
acagaaaatcattgccagactttgacaaggacggtgtgtgcagaacaatgtgacggcaga
tgctacggaccttacgtcagtgactgctgccatcgagaatgtgctggaggctgctcagga
cctaaggacacagactgctttgcctgcatgaatttcaatgacagtggagcatgtgttact
cagtgtccccaaacctttgtctacaatccaaccacctttcaactggagcacaatttcaat
gcaaagtacacatatggagcattctgtgtcaagaaatgtccacataactttgtggtagat
tccagttcttgtgtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggatt
aaaatgtgtaaaccttgcactgacatttgcccaaaagcttgtgatggcattggcacagga
tcattgatgtcagctcagactgtggattccagtaacattgacaaattcataaactgtacc
aagatcaatgggaatttgatctttctagtcactggtattcatggggacccttacaatgca
attgaagccatagacccagagaaactgaacgtctttcggacagtcagagagataacaggt
ttcctgaacatacagtcatggccaccaaacatgactgacttcagtgttttttctaacctg
gtgaccattggtggaagagtactctatagtggcctgtccttgcttatcctcaagcaacag
ggcatcacctctctacagttccagtccctgaaggaaatcagcgcaggaaacatctatatt
actgacaacagcaacctgtgttattatcataccattaactggacaacactcttcagcaca
atcaaccagagaatagtaatccgggacaacagaaaagctgaaaattgtactgctgaagga
atggtgtgcaaccatctgtgttccagtgatggctgttggggacctgggccagaccaatgt
ctgtcgtgtcgccgcttcagtagaggaaggatctgcatagagtcttgtaacctctatgat
ggtgaatttcgggagtttgagaatggctccatctgtgtggagtgtgacccccagtgtgag
aagatggaagatggcctcctcacatgccatggaccgggtcctgacaactgtacaaagtgc
tctcattttaaagatggcccaaactgtgtggaaaaatgtccagatggcttacagggggca
aacagtttcattttcaagtatgctgatccagatcgggagtgccacccatgccatccaaac
tgcacccaagggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactcccctgattgcagctggagtaattggtggg
ctcttcattctggtcattgtgggtctgacatttgctgtttatgttagaaggaagagcatc
aaaaagaaaagagccttgagaagattcttggaaacagagttggtggaaccattaactccc
agtggcacagcacccaatcaagctcaacttcgtattttgaaagaaactgagctgaagagg
gtaaaagtccttggctcaggtgcttttggaacggtttataaaggtatttgggtacctgaa
ggagaaactgtgaagattcctgtggctattaagattcttaatgagacaactggtcccaag
gcaaatgtggagttcatggatgaagctctgatcatggcaagtatggatcatccacaccta
gtccggttgctgggtgtgtgtctgagcccaaccatccagctggttactcaacttatgccc
catggctgcctgttggagtatgtccacgagcacaaggataacattggatcacaactgctg
cttaactggtgtgtccagatagctaagggaatgatgtacctggaagaaagacgactcgtt
catcgggatttggcagcccgtaatgtcttagtgaaatctccaaaccatgtgaaaatcaca
gattttgggctagccagactcttggaaggagatgaaaaagagtacaatgctgatggagga
aagatgccaattaaatggatggctctggagtgtatacattacaggaaattcacccatcag
agtgacgtttggagctatggagttactatatgggaactgatgacctttggaggaaaaccc
tatgatggaattccaacgcgagaaatccctgatttattagagaaaggagaacgtttgcct
cagcctcccatctgcactattgacgtttacatggtcatggtcaaatgttggatgattgat
gctgacagtagacctaaatttaaggaactggctgctgagttttcaaggatggctcgagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaatgac
agcaagttctttcagaatctcttggatgaagaggatttggaagatatgatggatgctgag
gagtacttggtccctcaggctttcaacatcccacctcccatctatacttccagagcaaga
attgactcgaataggaaccagtttgtataccgagatggaggttttgctgctgaacaagga
gtgtctgtgccctacagagccccaactagcacaattccagaagctcctgtggcacagggt
gctactgctgagatttttgatgactcctgctgtaatggcaccctacgcaagccagtggca
ccccatgtccaagaggacagtagcacccagaggtacagtgctgaccccaccgtgtttgcc
ccagaacggagcccacgaggagagctggatgaggaaggttacatgactcctatgcgagac
aaacccaaacaagaatacctgaatccagtggaggagaacccttttgtttctcggagaaaa
aatggagaccttcaagcattggataatcccgaatatcacaatgcatccaatggtccaccc
aaggccgaggatgagtatgtgaatgagccactgtacctcaacacctttgccaacaccttg
ggaaaagctgagtacctgaagaacaacatactgtcaatgccagagaaggccaagaaagcg
tttgacaaccctgactactggaaccacagcctgccacctcggagcacccttcagcaccca
gactacctgcaggagtacagcacaaaatatttttataaacagaatgggcggatccggcct
attgtggcagagaatcctgaatacctctctgagttctccctgaagccaggcactgtgctg
ccgcctccaccttacagacaccggaatactgtggtgtaa

DBGET integrated database retrieval system