KEGG   Homo sapiens (human): 207Help
Entry
207               CDS       T01001                                 

Gene name
AKT1, AKT, CWS6, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA
Definition
v-akt murine thymoma viral oncogene homolog 1 (EC:2.7.11.1)
Orthology
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Carbohydrate digestion and absorption
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Disease
H00539  
PTEN hamartoma tumor syndrome (PHTS)
Drug target
Other: 
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:hsa04370]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:hsa04630]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:hsa04150]
Cellular Processes; Cell growth and death; Apoptosis [PATH:hsa04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:hsa04664]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; Estrogen signaling pathway [PATH:hsa04915]
Organismal Systems; Endocrine system; Progesterone-mediated oocyte maturation [PATH:hsa04914]
Organismal Systems; Endocrine system; Prolactin signaling pathway [PATH:hsa04917]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:hsa04261]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:hsa04973]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:hsa04725]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:hsa04728]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Colorectal cancer [PATH:hsa05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Cancers; Endometrial cancer [PATH:hsa05213]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:hsa05145]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:hsa05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.32
AA seq 480 aa AA seqDB search
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggttggctgcacaaacgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaatgatggcaccttcattggctacaaggag
cggccgcaggatgtggaccaacgtgaggctcccctcaacaacttctctgtggcgcagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccatgtggagactcctgaggagcgggaggagtggaca
accgccatccagactgtggctgacggcctcaagaagcaggaggaggaggagatggacttc
cggtcgggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
ttcggcaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctcaagaaggaagtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgc
gtcctgcagaactccaggcaccccttcctcacagccctgaagtactctttccagacccac
gaccgcctctgctttgtcatggagtacgccaacgggggcgagctgttcttccacctgtcc
cgggagcgtgtgttctccgaggaccgggcccgcttctatggcgctgagattgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggtgccaccatgaagaccttttgcggcacacctgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggtcgcctgcccttctacaaccaggaccatgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcccgaggccaagtccttgctt
tcagggctgctcaagaaggaccccaagcagaggcttggcgggggctccgaggacgccaag
gagatcatgcagcatcgcttctttgccggtatcgtgtggcagcacgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacgtcggagactgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagatgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

DBGET integrated database retrieval system