KEGG   Homo sapiens (human): 207Help
Entry
207               CDS       T01001                                 

Gene name
AKT1, AKT, CWS6, PKB, PKB-ALPHA, PRKBA, RAC, RAC-ALPHA
Definition
v-akt murine thymoma viral oncogene homolog 1 (EC:2.7.11.1)
Orthology
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Carbohydrate digestion and absorption
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Module
PI3K-Akt signaling
Disease
H00539  
PTEN hamartoma tumor syndrome (PHTS)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    207 (AKT1)
   04015 Rap1 signaling pathway
    207 (AKT1)
   04010 MAPK signaling pathway
    207 (AKT1)
   04012 ErbB signaling pathway
    207 (AKT1)
   04370 VEGF signaling pathway
    207 (AKT1)
   04630 Jak-STAT signaling pathway
    207 (AKT1)
   04668 TNF signaling pathway
    207 (AKT1)
   04066 HIF-1 signaling pathway
    207 (AKT1)
   04068 FoxO signaling pathway
    207 (AKT1)
   04024 cAMP signaling pathway
    207 (AKT1)
   04022 cGMP - PKG signaling pathway
    207 (AKT1)
   04151 PI3K-Akt signaling pathway
    207 (AKT1)
   04152 AMPK signaling pathway
    207 (AKT1)
   04150 mTOR signaling pathway
    207 (AKT1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    207 (AKT1)
  Cellular commiunity
   04510 Focal adhesion
    207 (AKT1)
   04530 Tight junction
    207 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    207 (AKT1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    207 (AKT1)
   04620 Toll-like receptor signaling pathway
    207 (AKT1)
   04660 T cell receptor signaling pathway
    207 (AKT1)
   04662 B cell receptor signaling pathway
    207 (AKT1)
   04664 Fc epsilon RI signaling pathway
    207 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    207 (AKT1)
   04062 Chemokine signaling pathway
    207 (AKT1)
  Endocrine system
   04910 Insulin signaling pathway
    207 (AKT1)
   04920 Adipocytokine signaling pathway
    207 (AKT1)
   04915 Estrogen signaling pathway
    207 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    207 (AKT1)
   04917 Prolactin signaling pathway
    207 (AKT1)
   04919 Thyroid hormone signaling pathway
    207 (AKT1)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    207 (AKT1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    207 (AKT1)
  Nervous system
   04725 Cholinergic synapse
    207 (AKT1)
   04728 Dopaminergic synapse
    207 (AKT1)
   04722 Neurotrophin signaling pathway
    207 (AKT1)
  Development
   04380 Osteoclast differentiation
    207 (AKT1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    207 (AKT1)
   05230 Central carbon metabolism in cancer
    207 (AKT1)
   05231 Choline metabolism in cancer
    207 (AKT1)
   05205 Proteoglycans in cancer
    207 (AKT1)
   05210 Colorectal cancer
    207 (AKT1)
   05212 Pancreatic cancer
    207 (AKT1)
   05214 Glioma
    207 (AKT1)
   05221 Acute myeloid leukemia
    207 (AKT1)
   05220 Chronic myeloid leukemia
    207 (AKT1)
   05218 Melanoma
    207 (AKT1)
   05211 Renal cell carcinoma
    207 (AKT1)
   05215 Prostate cancer
    207 (AKT1)
   05213 Endometrial cancer
    207 (AKT1)
   05222 Small cell lung cancer
    207 (AKT1)
   05223 Non-small cell lung cancer
    207 (AKT1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    207 (AKT1)
  Infectious diseases
   05152 Tuberculosis
    207 (AKT1)
   05166 HTLV-I infection
    207 (AKT1)
   05162 Measles
    207 (AKT1)
   05164 Influenza A
    207 (AKT1)
   05161 Hepatitis B
    207 (AKT1)
   05160 Hepatitis C
    207 (AKT1)
   05169 Epstein-Barr virus infection
    207 (AKT1)
   05145 Toxoplasmosis
    207 (AKT1)
   05142 Chagas disease (American trypanosomiasis)
    207 (AKT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     207 (AKT1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  AKT family
   207 (AKT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.32
AA seq 480 aa AA seqDB search
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggttggctgcacaaacgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaatgatggcaccttcattggctacaaggag
cggccgcaggatgtggaccaacgtgaggctcccctcaacaacttctctgtggcgcagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccatgtggagactcctgaggagcgggaggagtggaca
accgccatccagactgtggctgacggcctcaagaagcaggaggaggaggagatggacttc
cggtcgggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaacgagtttgagtacctgaagctgctgggcaagggcact
ttcggcaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctcaagaaggaagtcatcgtggccaaggacgaggtggcccacacactcaccgagaaccgc
gtcctgcagaactccaggcaccccttcctcacagccctgaagtactctttccagacccac
gaccgcctctgctttgtcatggagtacgccaacgggggcgagctgttcttccacctgtcc
cgggagcgtgtgttctccgaggaccgggcccgcttctatggcgctgagattgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggtgccaccatgaagaccttttgcggcacacctgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggtcgcctgcccttctacaaccaggaccatgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcccgaggccaagtccttgctt
tcagggctgctcaagaaggaccccaagcagaggcttggcgggggctccgaggacgccaag
gagatcatgcagcatcgcttctttgccggtatcgtgtggcagcacgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacgtcggagactgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagatgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

DBGET integrated database retrieval system