KEGG   Homo sapiens (human): 208Help
Entry
208               CDS       T01001                                 

Gene name
AKT2, HIHGHH, PKBB, PKBBETA, PRKBB, RAC-BETA
Definition
v-akt murine thymoma viral oncogene homolog 2 (EC:2.7.11.1)
Orthology
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Carbohydrate digestion and absorption
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Disease
H00027  
Ovarian cancer
H00420  
Familial partial lipodystrophy (FPL)
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    208 (AKT2)
   04015 Rap1 signaling pathway
    208 (AKT2)
   04010 MAPK signaling pathway
    208 (AKT2)
   04012 ErbB signaling pathway
    208 (AKT2)
   04370 VEGF signaling pathway
    208 (AKT2)
   04630 Jak-STAT signaling pathway
    208 (AKT2)
   04668 TNF signaling pathway
    208 (AKT2)
   04066 HIF-1 signaling pathway
    208 (AKT2)
   04068 FoxO signaling pathway
    208 (AKT2)
   04024 cAMP signaling pathway
    208 (AKT2)
   04022 cGMP - PKG signaling pathway
    208 (AKT2)
   04151 PI3K-Akt signaling pathway
    208 (AKT2)
   04152 AMPK signaling pathway
    208 (AKT2)
   04150 mTOR signaling pathway
    208 (AKT2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    208 (AKT2)
  Cell communication
   04510 Focal adhesion
    208 (AKT2)
   04530 Tight junction
    208 (AKT2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    208 (AKT2)
   04620 Toll-like receptor signaling pathway
    208 (AKT2)
   04660 T cell receptor signaling pathway
    208 (AKT2)
   04662 B cell receptor signaling pathway
    208 (AKT2)
   04664 Fc epsilon RI signaling pathway
    208 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    208 (AKT2)
   04062 Chemokine signaling pathway
    208 (AKT2)
  Endocrine system
   04910 Insulin signaling pathway
    208 (AKT2)
   04920 Adipocytokine signaling pathway
    208 (AKT2)
   04915 Estrogen signaling pathway
    208 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    208 (AKT2)
   04917 Prolactin signaling pathway
    208 (AKT2)
   04919 Thyroid hormone signaling pathway
    208 (AKT2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    208 (AKT2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    208 (AKT2)
  Nervous system
   04725 Cholinergic synapse
    208 (AKT2)
   04728 Dopaminergic synapse
    208 (AKT2)
   04722 Neurotrophin signaling pathway
    208 (AKT2)
  Development
   04380 Osteoclast differentiation
    208 (AKT2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    208 (AKT2)
   05205 Proteoglycans in cancer
    208 (AKT2)
   05210 Colorectal cancer
    208 (AKT2)
   05212 Pancreatic cancer
    208 (AKT2)
   05214 Glioma
    208 (AKT2)
   05221 Acute myeloid leukemia
    208 (AKT2)
   05220 Chronic myeloid leukemia
    208 (AKT2)
   05218 Melanoma
    208 (AKT2)
   05211 Renal cell carcinoma
    208 (AKT2)
   05215 Prostate cancer
    208 (AKT2)
   05213 Endometrial cancer
    208 (AKT2)
   05222 Small cell lung cancer
    208 (AKT2)
   05223 Non-small cell lung cancer
    208 (AKT2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    208 (AKT2)
  Infectious diseases
   05152 Tuberculosis
    208 (AKT2)
   05166 HTLV-I infection
    208 (AKT2)
   05162 Measles
    208 (AKT2)
   05164 Influenza A
    208 (AKT2)
   05161 Hepatitis B
    208 (AKT2)
   05160 Hepatitis C
    208 (AKT2)
   05169 Epstein-Barr virus infection
    208 (AKT2)
   05145 Toxoplasmosis
    208 (AKT2)
   05142 Chagas disease (American trypanosomiasis)
    208 (AKT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     208 (AKT2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  AKT family
   208 (AKT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1-q13.2
AA seq 419 aa AA seqDB search
MKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDY
KCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKI
LRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLS
RERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEGIS
DGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELI
LMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKL
LPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgagaggccgcgacccaacacctttgtcatacgctgcctgcagtggaccaca
gtcatcgagaggaccttccacgtggattctccagacgagagggaggagtggatgcgggcc
atccagatggtcgccaacagcctcaagcagcgggccccaggcgaggaccccatggactac
aagtgtggctcccccagtgactcctccacgactgaggagatggaagtggcggtcagcaag
gcacgggctaaagtgaccatgaatgacttcgactatctcaaactccttggcaagggaacc
tttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatgaagatc
ctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgagagccgg
gtcctccagaacaccaggcacccgttcctcactgcgctgaagtatgccttccagacccac
gaccgcctgtgctttgtgatggagtatgccaacgggggtgagctgttcttccacctgtcc
cgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagattgtctcggct
cttgagtacttgcactcgcgggacgtggtataccgcgacatcaagctggaaaacctcatg
ctggacaaagatggccacatcaagatcactgactttggcctctgcaaagagggcatcagt
gacggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcctgaggtgctg
gaggacaatgactatggccgggccgtggactggtgggggctgggtgtggtcatgtacgag
atgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgagctcatc
ctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctgcttgct
gggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgccaaggag
gtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaagaagctc
ctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtacttcgatgatgaa
tttaccgcccagtccatcacaatcacaccccctgaccgctatgacagcctgggcttactg
gagctggaccagcggacccacttcccccagttctcctactcggccagcatccgcgagtga

DBGET integrated database retrieval system