KEGG   Homo sapiens (human): 208Help
Entry
208               CDS       T01001                                 

Gene name
AKT2, HIHGHH, PKBB, PKBBETA, PRKBB, RAC-BETA
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
Platinum drug resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Apelin signaling pathway
Osteoclast differentiation
Focal adhesion
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
C-type lectin receptor signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Relaxin signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Carbohydrate digestion and absorption
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
Human papillomavirus infection
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Fluid shear stress and atherosclerosis
Module
PI3K-Akt signaling
Network
N00030  
EGF-EGFR-RAS-PI3K signaling pathway
N00031  
Duplication-activated FLT3 to RAS-PI3K signaling pathway
N00032  
Mutation-activated KRAS/NRAS to PI3K signaling pathway
N00033  
EGF-EGFR-PI3K signaling pathway
N00034  
ERBB2-overexpression to PI3K signaling pathway
N00035  
Amplified EGFR to PI3K signaling pathway
N00036  
Mutation-activated EGFR to PI3K signaling pathway
N00037  
FGF-FGFR-PI3K signaling pathway
N00038  
Amplified FGFR to PI3K signaling pathway
N00039  
PDGF-PDGFR-PI3K signaling pathway
N00040  
Amplified PDGFR to PI3K signaling pathway
N00042  
EGFR-overexpression to PI3K signaling pathway
N00043  
HGF-MET-PI3K signaling pathway
N00044  
Mutation-activated MET to PI3K signaling pathway
N00045  
KITLG-KIT-PI3K signaling pathway
N00046  
Mutation-activated KIT to PI3K signaling pathway
N00047  
EML4-ALK fusion kinase to PI3K signaling pathway
N00048  
BCR-ABL fusion kinase to PI3K signaling pathway
N00049  
Mutation-activated PI3K to PI3K signaling pathway
N00050  
Amplified PI3K to PI3K signaling pathway
N00051  
Deleted PTEN to PI3K signaling pathway
N00052  
Mutation-inactivated PTEN to PI3K signaling pathway
N00082  
Loss of NKX3-1 to PI3K signaling pathway
N00154  
CXCR-GNB/G-PI3K-AKT signaling pathway
N00158  
KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00159  
KSHV K1 to PI3K signaling pathway
N00179  
KSHV K1 to PI3K-NFKB signaling pathway
N00182  
IGF-IGFR-PI3K-NFKB signaling pathway
N00218  
FLT3LG-FLT3-RAS-PI3K signaling pathway
N00220  
PTEN-PI3K-AKT signaling pathway
N00231  
TGFA-EGFR-PI3K signaling pathway
N00232  
TGFA-overexpression to PI3K signaling pathway
N00234  
IGF2-IGF1R-PI3K signaling pathway
N00236  
IGF2-overexpression to PI3K signaling pathway
N00238  
IGF1R-overexpression to PI3K signaling pathway
N00247  
HGF-overexpression to PI3K signaling pathway
N00249  
MET-overexpression to PI3K signaling pathway
N00253  
Amplified ERBB2 to PI3K signaling pathway
N00260  
Amplified MET to PI3K signaling pathway
N00281  
EGF-overexpression to PI3K signaling pathway
N00282  
EREG-EGFR-PI3K signaling pathway
N00283  
EREG-overexpression to PI3K signaling pathway
N00284  
AREG-EGFR-PI3K signaling pathway
N00285  
AREG-overexpression to PI3K signaling pathway
Disease
H00027  
Ovarian cancer
H00420  
Familial partial lipodystrophy (FPL)
H01909  
Hypoinsulinemic hypoglycemia with hemihypertrophy (HIHGHH)
Drug target
Afuresertib (DG01408): 
Ipatasertib: 
Uprosertib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    208 (AKT2)
   04015 Rap1 signaling pathway
    208 (AKT2)
   04010 MAPK signaling pathway
    208 (AKT2)
   04012 ErbB signaling pathway
    208 (AKT2)
   04370 VEGF signaling pathway
    208 (AKT2)
   04371 Apelin signaling pathway
    208 (AKT2)
   04630 Jak-STAT signaling pathway
    208 (AKT2)
   04668 TNF signaling pathway
    208 (AKT2)
   04066 HIF-1 signaling pathway
    208 (AKT2)
   04068 FoxO signaling pathway
    208 (AKT2)
   04072 Phospholipase D signaling pathway
    208 (AKT2)
   04071 Sphingolipid signaling pathway
    208 (AKT2)
   04024 cAMP signaling pathway
    208 (AKT2)
   04022 cGMP - PKG signaling pathway
    208 (AKT2)
   04151 PI3K-Akt signaling pathway
    208 (AKT2)
   04152 AMPK signaling pathway
    208 (AKT2)
   04150 mTOR signaling pathway
    208 (AKT2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    208 (AKT2)
  Cell growth and death
   04210 Apoptosis
    208 (AKT2)
   04218 Cellular senescence
    208 (AKT2)
  Cellular community - eukaryotes
   04510 Focal adhesion
    208 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    208 (AKT2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    208 (AKT2)
   04620 Toll-like receptor signaling pathway
    208 (AKT2)
   04625 C-type lectin receptor signaling pathway
    208 (AKT2)
   04660 T cell receptor signaling pathway
    208 (AKT2)
   04662 B cell receptor signaling pathway
    208 (AKT2)
   04664 Fc epsilon RI signaling pathway
    208 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    208 (AKT2)
   04062 Chemokine signaling pathway
    208 (AKT2)
  Endocrine system
   04910 Insulin signaling pathway
    208 (AKT2)
   04922 Glucagon signaling pathway
    208 (AKT2)
   04923 Regulation of lipolysis in adipocyte
    208 (AKT2)
   04920 Adipocytokine signaling pathway
    208 (AKT2)
   04915 Estrogen signaling pathway
    208 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    208 (AKT2)
   04917 Prolactin signaling pathway
    208 (AKT2)
   04926 Relaxin signaling pathway
    208 (AKT2)
   04919 Thyroid hormone signaling pathway
    208 (AKT2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    208 (AKT2)
  Digestive system
   04973 Carbohydrate digestion and absorption
    208 (AKT2)
  Nervous system
   04725 Cholinergic synapse
    208 (AKT2)
   04728 Dopaminergic synapse
    208 (AKT2)
   04722 Neurotrophin signaling pathway
    208 (AKT2)
  Development
   04380 Osteoclast differentiation
    208 (AKT2)
  Aging
   04211 Longevity regulating pathway - mammal
    208 (AKT2)
   04213 Longevity regulating pathway - multiple species
    208 (AKT2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    208 (AKT2)
   05230 Central carbon metabolism in cancer
    208 (AKT2)
   05231 Choline metabolism in cancer
    208 (AKT2)
   05205 Proteoglycans in cancer
    208 (AKT2)
   05210 Colorectal cancer
    208 (AKT2)
   05212 Pancreatic cancer
    208 (AKT2)
   05225 Hepatocellular carcinoma
    208 (AKT2)
   05226 Gastric cancer
    208 (AKT2)
   05214 Glioma
    208 (AKT2)
   05221 Acute myeloid leukemia
    208 (AKT2)
   05220 Chronic myeloid leukemia
    208 (AKT2)
   05218 Melanoma
    208 (AKT2)
   05211 Renal cell carcinoma
    208 (AKT2)
   05215 Prostate cancer
    208 (AKT2)
   05213 Endometrial cancer
    208 (AKT2)
   05224 Breast cancer
    208 (AKT2)
   05222 Small cell lung cancer
    208 (AKT2)
   05223 Non-small cell lung cancer
    208 (AKT2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    208 (AKT2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    208 (AKT2)
   04931 Insulin resistance
    208 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    208 (AKT2)
  Infectious diseases
   05152 Tuberculosis
    208 (AKT2)
   05166 HTLV-I infection
    208 (AKT2)
   05162 Measles
    208 (AKT2)
   05164 Influenza A
    208 (AKT2)
   05161 Hepatitis B
    208 (AKT2)
   05160 Hepatitis C
    208 (AKT2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    208 (AKT2)
   05169 Epstein-Barr virus infection
    208 (AKT2)
   05165 Human papillomavirus infection
    208 (AKT2)
   05145 Toxoplasmosis
    208 (AKT2)
   05142 Chagas disease (American trypanosomiasis)
    208 (AKT2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    208 (AKT2)
   01524 Platinum drug resistance
    208 (AKT2)
   01522 Endocrine resistance
    208 (AKT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     208 (AKT2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   208 (AKT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P31751(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.2
AA seq 481 aa AA seqDB search
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagcgacggctccttcattgggtacaaggag
aggcccgaggcccctgatcagactctaccccccttaaacaacttctccgtagcagaatgc
cagctgatgaagaccgagaggccgcgacccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagacgagagggaggagtggatg
cgggccatccagatggtcgccaacagcctcaagcagcgggccccaggcgaggaccccatg
gactacaagtgtggctcccccagtgactcctccacgactgaggagatggaagtggcggtc
agcaaggcacgggctaaagtgaccatgaatgacttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtatgccttccag
acccacgaccgcctgtgctttgtgatggagtatgccaacgggggtgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagattgtc
tcggctcttgagtacttgcactcgcgggacgtggtataccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgactttggcctctgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag
gtgctggaggacaatgactatggccgggccgtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtacttcgat
gatgaatttaccgcccagtccatcacaatcacaccccctgaccgctatgacagcctgggc
ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

DBGET integrated database retrieval system