KEGG   Homo sapiens (human): 2091Help
Entry
2091              CDS       T01001                                 

Gene name
FBL, FIB, FLRN, RNU3IP1
Definition
fibrillarin
Orthology
K14563  
rRNA 2'-O-methyltransferase fibrillarin [EC:2.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    2091 (FBL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     2091 (FBL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 321 aa AA seqDB search
MKPGFSPRGGGFGGRGGFGDRGGRGGRGGFGGGRGRGGGFRGRGRGGGGGGGGGGGGGRG
GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKNLVPGESVYGE
KRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHIKPGAKVLYLGAASGTTVSHVSDI
VGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIEDARHPHKYRMLIAMVDVIFADVAQP
DQTRIVALNAHTFLRNGGHFVISIKANCIDSTASAEAVFASEVKKMQQENMKPQEQLTLE
PYERDHAVVVGVYRPPPKVKN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaggattcagtccccgtgggggtggctttggcggccgagggggctttggtgac
cgtggtggtcgtggaggccgagggggctttggcgggggccgaggtcgaggcggaggcttt
agaggtcgtggacgaggaggaggtggaggcggcggcggcggtggaggaggaggaagaggt
ggtggaggcttccattctggtggcaaccggggtcgtggtcggggaggaaaaagaggaaac
cagtcggggaagaatgtgatggtggagccgcatcggcatgagggtgtcttcatttgtcga
ggaaaggaagatgcactggtcaccaagaacctggtccctggggaatcagtttatggagag
aagagagtctcgatttcggaaggagatgacaaaattgagtaccgagcctggaaccccttc
cgctccaagctagcagcagcaatcctgggtggtgtggaccagatccacatcaaaccgggg
gctaaggttctctacctcggggctgcctcgggcaccacggtctcccatgtctctgacatc
gttggtccggatggtctagtctatgcagtcgagttctcccaccgctctggccgtgacctc
attaacttggccaagaagaggaccaacatcattcctgtgatcgaggatgctcgacaccca
cacaaataccgcatgctcatcgcaatggtggatgtgatctttgctgatgtggcccagcca
gaccagacccggattgtggccctgaatgcccacaccttcctgcgtaatggaggacacttt
gtgatttccattaaggccaactgcattgactccacagcctcagccgaggccgtgtttgcc
tccgaagtgaaaaagatgcaacaggagaacatgaagccgcaggagcagttgacccttgag
ccatatgaaagagaccatgccgtggtcgtgggagtgtacaggccaccccccaaggtgaag
aactga

DBGET integrated database retrieval system