KEGG   Homo sapiens (human): 210Help
Entry
210               CDS       T01001                                 

Gene name
ALAD, ALADH, PBGS
Definition
aminolevulinate dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Disease
H00202  
Hepatic porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    210 (ALAD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     210 (ALAD)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   210 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q33.1
AA seq 330 aa AA seqDB search
MQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLPGVARYGVKR
LEEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKTFPNLLVACD
VCLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMMDGRVEAIKE
ALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDR
DVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAV
LEAMTAFRRAGADIIITYYTPQLLQWLKEE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagtccgttctgcacagcggctacttccacccactacttcgggcctggcag
acagccaccaccaccctcaatgcctccaacctcatctaccccatctttgtcacggatgtt
cctgatgacatacagcctatcaccagcctcccaggagtggccaggtatggtgtgaagcgg
ctggaagagatgctgaggcccttggtggaagagggcctacgctgtgtcttgatctttggc
gtccccagcagagttcccaaggacgagcggggttccgcagctgactccgaggagtcccca
gctattgaggcaatccatctgttgaggaagaccttccccaacctcctggtggcctgtgat
gtctgcctgtgtccctacacctcccatggtcactgcgggctcctgagtgaaaacggagca
ttccgggctgaggagagccgccagcggctggctgaggtggcattggcgtatgccaaggca
ggatgtcaggtggtagccccgtcggacatgatggatggacgcgtggaagccatcaaagag
gccctgatggcacatggacttggcaacagggtatcggtgatgagctacagtgccaaattt
gcttcctgtttctatggccctttccgggatgcagctaagtcaagcccagcttttggggac
cgccgctgctaccagctgccccctggagcacgaggcctggctctccgagctgtggaccgg
gatgtacgggaaggagctgacatgctcatggtgaagccgggaatgccctacctggacatc
gtgcgggaggtaaaggacaagcaccctgacctccctctcgccgtgtaccacgtctctgga
gagtttgccatgctgtggcatggagcccaggccggggcatttgatctcaaggctgccgta
ctggaggccatgactgccttccgcagagcaggtgctgacatcatcatcacctactacaca
ccgcagctgctgcagtggctgaaggaggaatga

DBGET integrated database retrieval system