KEGG   Homo sapiens (human): 2152Help
Entry
2152              CDS       T01001                                 

Gene name
F3, CD142, TF, TFA
Definition
(RefSeq) coagulation factor III, tissue factor
  KO
K03901  
coagulation factor III (tissue factor)
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
AGE-RAGE signaling pathway in diabetic complications
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2152 (F3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    2152 (F3)
Cellular antigens [BR:hsa04090]
 Proteins
  2152 (F3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2152 (F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p22-p21
AA seq 295 aa AA seqDB search
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagacccctgcctggccccgggtcccgcgccccgagaccgccgtcgctcggacgctc
ctgctcggctgggtcttcgcccaggtggccggcgcttcaggcactacaaatactgtggca
gcatataatttaacttggaaatcaactaatttcaagacaattttggagtgggaacccaaa
cccgtcaatcaagtctacactgttcaaataagcactaagtcaggagattggaaaagcaaa
tgcttttacacaacagacacagagtgtgacctcaccgacgagattgtgaaggatgtgaag
cagacgtacttggcacgggtcttctcctacccggcagggaatgtggagagcaccggttct
gctggggagcctctgtatgagaactccccagagttcacaccttacctggagacaaacctc
ggacagccaacaattcagagttttgaacaggtgggaacaaaagtgaatgtgaccgtagaa
gatgaacggactttagtcagaaggaacaacactttcctaagcctccgggatgtttttggc
aaggacttaatttatacactttattattggaaatcttcaagttcaggaaagaaaacagcc
aaaacaaacactaatgagtttttgattgatgtggataaaggagaaaactactgtttcagt
gttcaagcagtgattccctcccgaacagttaaccggaagagtacagacagcccggtagag
tgtatgggccaggagaaaggggaattcagagaaatattctacatcattggagctgtggta
tttgtggtcatcatccttgtcatcatcctggctatatctctacacaagtgtagaaaggca
ggagtggggcagagctggaaggagaactccccactgaatgtttcataa

DBGET integrated database retrieval system