KEGG   Homo sapiens (human): 2152Help
Entry
2152              CDS       T01001                                 

Gene name
F3, CD142, TF, TFA
Definition
(RefSeq) coagulation factor III, tissue factor
  KO
K03901  coagulation factor III (tissue factor)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04933  AGE-RAGE signaling pathway in diabetic complications
Drug target
Tifacogin: D06142
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2152 (F3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    2152 (F3)
CD molecules [BR:hsa04090]
 Proteins
  2152 (F3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2152 (F3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind Baculo_11_kDa TMEM154
Motif
Other DBs
NCBI-GeneID: 2152
NCBI-ProteinID: NP_001984
OMIM: 134390
HGNC: 3541
Ensembl: ENSG00000117525
Vega: OTTHUMG00000010716
Pharos: P13726(Tchem)
UniProt: P13726
Structure
PDB: 

Jmol
Position
1p21.3
AA seq 295 aa AA seqDB search
METPAWPRVPRPETAVARTLLLGWVFAQVAGASGTTNTVAAYNLTWKSTNFKTILEWEPK
PVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGS
AGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFG
KDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVE
CMGQEKGEFREIFYIIGAVVFVVIILVIILAISLHKCRKAGVGQSWKENSPLNVS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggagacccctgcctggccccgggtcccgcgccccgagaccgccgtcgctcggacgctc
ctgctcggctgggtcttcgcccaggtggccggcgcttcaggcactacaaatactgtggca
gcatataatttaacttggaaatcaactaatttcaagacaattttggagtgggaacccaaa
cccgtcaatcaagtctacactgttcaaataagcactaagtcaggagattggaaaagcaaa
tgcttttacacaacagacacagagtgtgacctcaccgacgagattgtgaaggatgtgaag
cagacgtacttggcacgggtcttctcctacccggcagggaatgtggagagcaccggttct
gctggggagcctctgtatgagaactccccagagttcacaccttacctggagacaaacctc
ggacagccaacaattcagagttttgaacaggtgggaacaaaagtgaatgtgaccgtagaa
gatgaacggactttagtcagaaggaacaacactttcctaagcctccgggatgtttttggc
aaggacttaatttatacactttattattggaaatcttcaagttcaggaaagaaaacagcc
aaaacaaacactaatgagtttttgattgatgtggataaaggagaaaactactgtttcagt
gttcaagcagtgattccctcccgaacagttaaccggaagagtacagacagcccggtagag
tgtatgggccaggagaaaggggaattcagagaaatattctacatcattggagctgtggta
tttgtggtcatcatccttgtcatcatcctggctatatctctacacaagtgtagaaaggca
ggagtggggcagagctggaaggagaactccccactgaatgtttcataa

DBGET integrated database retrieval system