KEGG   Homo sapiens (human): 2161Help
Entry
2161              CDS       T01001                                 

Gene name
F12, HAE3, HAEX, HAF
Definition
coagulation factor XII (Hageman factor) (EC:3.4.21.38)
Orthology
K01328  
coagulation factor XII (Hageman factor) [EC:3.4.21.38]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Disease
H00941  
Factor XII deficiency
H01006  
Hereditary angioedema
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    2161 (F12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.38  coagulation factor XIIa
     2161 (F12)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   2161 (F12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q35.3
AA seq 615 aa AA seqDB search
MRALLLLGFLLVSLESTLSIPPWEAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRQLYHK
CTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCL
CPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGAFCDVDTKASCYDGRGLSYRGLARTTLSGAPCQP
WASEATYRNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLNRDRLSWEYCDLAQCQTPTQ
AAPPTPVSPRLHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGS
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTVS
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgagggctctgctgctcctggggttcctgctggtgagcttggagtcaacactttcgatt
ccaccttgggaagcccccaaggagcataagtacaaagctgaagagcacacagtcgttctc
actgtcaccggggagccctgccacttccccttccagtaccaccggcagctgtaccacaaa
tgtacccacaagggccggccaggccctcagccctggtgtgctaccacccccaactttgat
caggaccagcgatggggatactgtttggagcccaagaaagtgaaagaccactgcagcaaa
cacagcccctgccagaaaggagggacctgtgtgaacatgccaagcggcccccactgtctc
tgtccacaacacctcactggaaaccactgccagaaagagaagtgctttgagcctcagctt
ctccggtttttccacaagaatgagatatggtatagaactgagcaagcagctgtggccaga
tgccagtgcaagggtcctgatgcccactgccagcggctggccagccaggcctgccgcacc
aacccgtgcctccatgggggtcgctgcctagaggtggagggccaccgcctgtgccactgc
ccggtgggctacaccggagccttctgcgacgtggacaccaaggcaagctgctatgatggc
cgcgggctcagctaccgcggcctggccaggaccacgctctcgggtgcgccctgtcagccg
tgggcctcggaggccacctaccggaacgtgactgccgagcaagcgcggaactggggactg
ggcggccacgccttctgccggaacccggacaacgacatccgcccgtggtgcttcgtgctg
aaccgcgaccggctgagctgggagtactgcgacctggcacagtgccagaccccaacccag
gcggcgcctccgaccccggtgtcccctaggcttcatgtcccactcatgcccgcgcagccg
gcaccgccgaagcctcagcccacgacccggaccccgcctcagtcccagaccccgggagcc
ttgccggcgaagcgggagcagccgccttccctgaccaggaacggcccactgagctgcggg
cagcggctccgcaagagtctgtcttcgatgacccgcgtcgttggcgggctggtggcgcta
cgcggggcgcacccctacatcgccgcgctgtactggggccacagtttctgcgccggcagc
ctcatcgccccctgctgggtgctgacggccgctcactgcctgcaggaccggcccgcaccc
gaggatctgacggtggtgctcggccaggaacgccgtaaccacagctgtgagccgtgccag
acgttggccgtgcgctcctaccgcttgcacgaggccttctcgcccgtcagctaccagcac
gacctggctctgttgcgccttcaggaggatgcggacggcagctgcgcgctcctgtcgcct
tacgttcagccggtgtgcctgccaagcggcgccgcgcgaccctccgagaccacgctctgc
caggtggccggctggggccaccagttcgagggggcggaggaatatgccagcttcctgcag
gaggcgcaggtaccgttcctctccctggagcgctgctcagccccggacgtgcacggatcc
tccatcctccccggcatgctctgcgcagggttcctcgagggcggcaccgatgcgtgccag
ggtgattccggaggcccgctggtgtgtgaggaccaagctgcagagcgccggctcaccctg
caaggcatcatcagctggggatcgggctgtggtgaccgcaacaagccaggcgtctacacc
gatgtggcctactacctggcctggatccgggagcacaccgtttcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system