KEGG   Homo sapiens (human): 2186Help
Entry
2186              CDS       T01001                                 

Gene name
BPTF, FAC1, FALZ, NURF301
Definition
(RefSeq) bromodomain PHD finger transcription factor
  KO
K11728  
nucleosome-remodeling factor subunit BPTF
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Chromatin remodeling factors
   NuRF complex
    2186 (BPTF)
   NuRF complex (fruit fly)
    2186 (BPTF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q24.3
AA seq 2920 aa AA seqDB search
MRGRRGRPPKQPAAPAAERCAPAPPPPPPPPTSGPIGGLRSRHRGSSRGRWAAAQAEVAP
KTRLSSPRGGSSSRRKPPPPPPAPPSTSAPGRGGRGGGGGRTGGGGGGGHLARTTAARRA
VNKVVYDDHESEEEEEEEDMVSEEEEEEDGDAEETQDSEDDEEDEMEEDDDDSDYPEEME
DDDDDASYCTESSFRSHSTYSSTPGRRKPRVHRPRSPILEEKDIPPLEFPKSSEDLMVPN
EHIMNVIAIYEVLRNFGTVLRLSPFRFEDFCAALVSQEQCTLMAEMHVVLLKAVLREEDT
SNTTFGPADLKDSVNSTLYFIDGMTWPEVLRVYCESDKEYHHVLPYQEAEDYPYGPVENK
IKVLQFLVDQFLTTNIAREELMSEGVIQYDDHCRVCHKLGDLLCCETCSAVYHLECVKPP
LEEVPEDEWQCEVCVAHKVPGVTDCVAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIE
EDTENENEKKIWYYSTKVQLAELIDCLDKDYWEAELCKILEEMREEIHRHMDITEDLTNK
ARGSNKSFLAAANEEILESIRAKKGDIDNVKSPEETEKDKNETENDSKDAEKNREEFEDQ
SLEKDSDDKTPDDDPEQGKSEVGDFKSEKSNGELSESPGAGKGASGSTRIITRLRNPDSK
LSQLKSQQVAAAAHEANKLFKEGKEVLVVNSQGEISRLSTKKEVIMKGNINNYFKLGQEG
KYRVYHNQYSTNSFALNKHQHREDHDKRRHLAHKFCLTPAGEFKWNGSVHGSKVLTISTL
RLTITQLENNIPSSFLHPNWASHRANWIKAVQMCSKPREFALALAILECAVKPVVMLPIW
RESLGHTRLHRMTSIEREEKEKVKKKEKKQEEEETMQQATWVKYTFPVKHQVWKQKGEEY
RVTGYGGWSWISKTHVYRFVPKLPGNTNVNYRKSLEGTKNNMDENMDESDKRKCSRSPKK
IKIEPDSEKDEVKGSDAAKGADQNEMDISKITEKKDQDVKELLDSDSDKPCKEEPMEVDD
DMKTESHVNCQESSQVDVVNVSEGFHLRTSYKKKTKSSKLDGLLERRIKQFTLEEKQRLE
KIKLEGGIKGIGKTSTNSSKNLSESPVITKAKEGCQSDSMRQEQSPNANNDQPEDLIQGC
SESDSSVLRMSDPSHTTNKLYPKDRVLDDVSIRSPETKCPKQNSIENDIEEKVSDLASRG
QEPSKSKTKGNDFFIDDSKLASADDIGTLICKNKKPLIQEESDTIVSSSKSALHSSVPKS
TNDRDATPLSRAMDFEGKLGCDSESNSTLENSSDTVSIQDSSEEDMIVQNSNESISEQFR
TREQDVEVLEPLKCELVSGESTGNCEDRLPVKGTEANGKKPSQQKKLEERPVNKCSDQIK
LKNTTDKKNNENRESEKKGQRTSTFQINGKDNKPKIYLKGECLKEISESRVVSGNVEPKV
NNINKIIPENDIKSLTVKESAIRPFINGDVIMEDFNERNSSETKSHLLSSSDAEGNYRDS
LETLPSTKESDSTQTTTPSASCPESNSVNQVEDMEIETSEVKKVTSSPITSEEESNLSND
FIDENGLPINKNENVNGESKRKTVITEVTTMTSTVATESKTVIKVEKGDKQTVVSSTENC
AKSTVTTTTTTVTKLSTPSTGGSVDIISVKEQSKTVVTTTVTDSLTTTGGTLVTSMTVSK
EYSTRDKVKLMKFSRPKKTRSGTALPSYRKFVTKSSKKSIFVLPNDDLKKLARKGGIREV
PYFNYNAKPALDIWPYPSPRPTFGITWRYRLQTVKSLAGVSLMLRLLWASLRWDDMAAKA
PPGGGTTRTETSETEITTTEIIKRRDVGPYGIRSEYCIRKIICPIGVPETPKETPTPQRK
GLRSSALRPKRPETPKQTGPVIIETWVAEEELELWEIRAFAERVEKEKAQAVEQQAKKRL
EQQKPTVIATSTTSPTSSTTSTISPAQKVMVAPISGSVTTGTKMVLTTKVGSPATVTFQQ
NKNFHQTFATWVKQGQSNSGVVQVQQKVLGIIPSSTGTSQQTFTSFQPRTATVTIRPNTS
GSGGTTSNSQVITGPQIRPGMTVIRTPLQQSTLGKAIIRTPVMVQPGAPQQVMTQIIRGQ
PVSTAVSAPNTVSSTPGQKSLTSATSTSNIQSSASQPPRPQQGQVKLTMAQLTQLTQGHG
GNQGLTVVIQGQGQTTGQLQLIPQGVTVLPGPGQQLMQAAMPNGTVQRFLFTPLATTATT
ASTTTTTVSTTAAGTGEQRQSKLSPQMQVHQDKTLPPAQSSSVGPAEAQPQTAQPSAQPQ
PQTQPQSPAQPEVQTQPEVQTQTTVSSHVPSEAQPTHAQSSKPQVAAQSQPQSNVQGQSP
VRVQSPSQTRIRPSTPSQLSPGQQSQVQTTTSQPIPIQPHTSLQIPSQGQPQSQPQVQSS
TQTLSSGQTLNQVTVSSPSRPQLQIQQPQPQVIAVPQLQQQVQVLSQIQSQVVAQIQAQQ
SGVPQQIKLQLPIQIQQSSAVQTHQIQNVVTVQAASVQEQLQRVQQLRDQQQKKKQQQIE
IKREHTLQASNQSEIIQKQVVMKHNAVIEHLKQKKSMTPAEREENQRMIVCNQVMKYILD
KIDKEEKQAAKKRKREESVEQKRSKQNATKLSALLFKHKEQLRAEILKKRALLDKDLQIE
VQEELKRDLKIKKEKDLMQLAQATAVAAPCPPVTPAPPAPPAPPPSPPPPPAVQHTGLLS
TPTLPAASQKRKREEEKDSSSKSKKKKMISTTSKETKKDTKLYCICKTPYDESKFYIGCD
RCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAH
KMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYY
NPSDSPFYQCAEVLESFFVQKLKGFKASRSHNNKLQSTAS
NT seq 8763 nt NT seq  +upstreamnt  +downstreamnt
atgaggggccggcggggcaggccgcccaagcagcccgcggctcccgctgcggagcgctgc
gccccggccccgccgccaccgccgccgccgcccacgtccggacccatcggggggctccgc
tcgcggcaccgcggcagcagccggggcaggtgggccgccgcccaggctgaggtggcgccc
aagacgcggctgagctcgcccagggggggcagcagtagccggaggaagccgccgccgccg
ccgccggccccccccagcaccagcgccccgggccggggggggcgaggaggcgggggcggc
aggacggggggcgggggcggcggcggccacctggcccggaccaccgcggcccggagggcc
gtcaacaaagtggtgtacgatgaccacgagagcgaggaggaggaggaagaggaggacatg
gtctccgaggaggaggaggaggaggacggcgacgccgaggagacccaggattctgaggac
gacgaggaggatgagatggaagaggacgacgatgactccgattatccggaggagatggaa
gacgacgacgacgacgccagttactgcacggaaagcagcttcaggagccatagtacctac
agcagcactccaggtaggcgaaaaccaagagtacatcggcctcgttctcctatattggaa
gaaaaagacatcccgccccttgaatttcccaagtcctctgaggatttaatggtgcctaat
gagcatataatgaatgtcattgccatttacgaggtactgcggaactttggcactgttttg
agattatctccttttcgctttgaggacttttgtgcagctctggtgagccaagagcagtgc
acactcatggcagagatgcatgttgtgcttttgaaagcagttctgcgtgaagaagacact
tccaatactacctttggacctgctgatctgaaagatagcgttaattccacactgtatttc
atagatgggatgacgtggccagaggtgctgcgggtgtactgtgagagtgataaggagtac
catcacgttcttccttaccaagaggcagaggactacccatatggaccagtagagaacaag
atcaaagttctacagtttctagtcgatcagtttcttacaacaaatattgctcgagaggaa
ttgatgtctgaaggggtgatacagtatgatgaccattgtagggtttgtcacaaacttggg
gatttgctttgctgtgagacatgttcagcagtataccatttggaatgtgtgaagccacct
cttgaggaggtgccagaggacgagtggcagtgtgaagtctgtgtagcacacaaggtgcct
ggtgtgactgactgtgttgctgaaatccaaaaaaataaaccatatattcgacatgaacct
attggatatgatagaagtcggaggaaatactggttcttgaaccgaagactcataatagaa
gaagatacagaaaatgaaaatgaaaagaaaatttggtattacagcacaaaggtccaactt
gcagaattaattgactgtctagacaaagattattgggaagcagaactctgcaaaattcta
gaagaaatgcgtgaagaaatccaccgacacatggacataactgaagacctgaccaataag
gctcggggcagtaacaaatcctttctggcggcagctaatgaagaaattttggaatccata
agagccaaaaagggagacattgataatgttaaaagcccagaagaaacagaaaaagacaag
aatgagactgagaatgactctaaagatgctgagaaaaacagagaagaatttgaagaccag
tcccttgaaaaagacagtgacgacaaaacaccagatgatgaccctgagcaaggaaaatct
gaggtaggtgatttcaaatcggagaagtccaacggggagctaagtgaatctcctggagct
ggaaaaggagcatctggctcaactcgaatcatcaccagattgcggaatccagatagcaaa
cttagtcagctgaagagccagcaggtggcagccgctgcacatgaagcaaataaattattt
aaggagggcaaagaggtactggtagttaactctcaaggagaaatttcacggttgagcacc
aaaaaggaagtgatcatgaaaggaaatatcaacaattattttaaattgggtcaagaaggg
aagtatcgcgtctaccacaatcaatactccaccaattcatttgctttgaataagcaccag
cacagagaagaccatgataagagaaggcatcttgcacataagttctgtctgactccagca
ggagagttcaaatggaacggttctgtccatgggtccaaagttcttaccatatctactctg
agactgactatcacccaattagaaaacaacatcccttcatcctttcttcatcccaactgg
gcatcacatagggcaaattggatcaaggcagttcagatgtgtagcaaacccagagaattt
gcattggctttagccattttggagtgtgcagttaaaccagttgtgatgctaccaatatgg
cgagaatctttaggacataccaggttacaccggatgacatcaattgaaagagaagaaaag
gagaaagtcaaaaaaaaagagaagaaacaggaagaagaagaaacgatgcagcaagcgaca
tgggtaaaatacacatttccagttaagcatcaggtttggaaacaaaaaggtgaagagtac
agagtgacaggatatggtggttggagctggattagtaaaactcatgtttataggtttgtt
cctaaattgccaggcaatactaatgtgaattacagaaagtcgttagaaggaaccaaaaat
aatatggatgaaaatatggatgagtcagataaaagaaaatgttcacgaagtccaaaaaaa
ataaaaatagagcctgattctgaaaaagatgaggtaaaaggttcagatgctgcaaaagga
gcagaccaaaatgaaatggatatctcaaagattactgagaagaaggaccaagatgtgaag
gagctcttagattctgacagtgataaaccctgcaaggaagaaccaatggaagtagacgat
gacatgaaaacagagtcacatgtaaattgtcaggagagttctcaagtagatgtggtcaat
gttagtgagggttttcatctaaggactagttacaaaaagaaaacaaaatcatccaaacta
gatggacttcttgaaaggagaattaaacagtttacactggaagaaaaacagcgactcgaa
aaaatcaagttggagggtggaattaagggtataggaaagacttctacaaattcttcaaaa
aatctctctgaatcaccagtaataacgaaagcaaaagaagggtgtcagagtgactcgatg
agacaagaacagagcccaaatgcaaataatgatcaacctgaggacttgattcagggatgt
tcagaaagtgattcctcagttcttagaatgagtgatcctagtcataccacaaacaaactt
tatccaaaagatcgagtgttagatgatgtctccattcggagcccagaaacaaaatgtccg
aaacaaaattccattgaaaatgacatagaagaaaaagtctctgaccttgccagtagaggc
caggaacccagtaagagtaaaacaaaaggaaatgattttttcatcgatgactctaaacta
gccagtgcagatgatattggtactttgatctgtaagaacaaaaaaccgctcatacaggag
gaaagtgacaccattgtttcttcttccaagagtgctttacattcatcagtgcctaaaagt
accaatgacagagatgccacacctctgtcaagagcaatggactttgaaggaaaactggga
tgtgactctgaatctaatagcactttggaaaatagttctgataccgtgtctattcaggat
agcagtgaagaagatatgattgttcagaatagcaatgaaagcatttctgaacagttcaga
actcgagaacaagatgttgaagtcttggagccgttaaagtgtgagttggtttctggtgag
tccactggaaactgtgaggacaggctgccggtcaaggggactgaagcaaatggtaaaaaa
ccaagtcagcagaagaaattagaggagagaccagttaataaatgtagtgatcaaataaag
ctaaaaaataccactgacaaaaagaataatgaaaatcgagagtctgaaaagaaaggacag
agaacaagtacatttcaaataaatggaaaagataataaacccaaaatatatttgaaaggt
gaatgcttgaaagaaatttctgagagtagagtagtaagtggtaatgttgaaccaaaggtt
aataatataaataaaataatccctgagaatgatattaaatcattgactgttaaagaatct
gctataaggccattcattaatggtgatgtcatcatggaagattttaatgaaagaaacagc
tccgaaacaaaatcgcatttgctgagttcttcagatgctgaaggtaactaccgagatagc
cttgagaccctgccatcaaccaaagagtctgacagtacacagacgaccacaccctcagca
tcttgtccagaaagcaattcagttaatcaggtagaagatatggaaatagaaacctcagaa
gttaagaaagttacttcatcacctattacttctgaagaggaatctaatctcagtaatgac
tttattgatgaaaatggtctgcccatcaacaaaaatgaaaatgtcaatggagaatctaaa
agaaaaaccgtcatcacagaagtcaccacgatgacctccacagtggccacagaatcaaaa
actgtgatcaaggtagaaaaaggcgataagcaaactgtggtttcttccacagaaaattgt
gcaaaatccactgtcacaaccaccactacaacagtgaccaagctttccacaccctccaca
ggcggcagtgtggacatcatctctgtaaaggagcagagcaaaaccgtggtcaccacgaca
gtgacagactccctgaccaccacgggaggcacactggttacatctatgactgtgagcaaa
gagtattccacacgagacaaagtgaaactgatgaaattttcaagaccaaagaagactcgt
tcaggtacagctctgccatcctatagaaaatttgttaccaagagcagcaagaagagcatt
tttgttttgcctaatgatgacttaaaaaagttggcccgaaaaggaggaatccgagaggtc
ccttattttaattacaatgcaaaacctgctttggatatatggccatatccttctcctaga
ccgacctttggcatcacttggaggtatagacttcagacagtaaagtccttagctggagtg
agcctgatgttacggttactgtgggcaagtttgagatgggatgatatggcggccaaggct
cctccaggaggagggactacacggacagaaacatccgaaactgaaatcacaacaacagaa
ataattaagaggagagatgttggtccttatggcattcgatctgaatattgtatcaggaaa
atcatttgtcccattggagttccagaaacaccaaaagaaacgcctacacctcagaggaaa
ggccttcgatcaagtgcactgcggccaaagagaccagaaacgcccaagcaaactggccct
gttattattgaaacctgggtagcagaagaagaactggaattgtgggagatcagggcattt
gctgagagagtggagaaagaaaaggcacaagcagttgagcaacaggctaagaaacgactg
gagcagcagaagccgacagtgattgcaacttccactacttccccaacaagcagtacaacc
agcaccatctctccagcacagaaggttatggtggcccccataagtggctcagttacaact
ggaaccaaaatggtactaactactaaagttggatctccagctacagtaacattccaacaa
aacaagaactttcatcaaacctttgctacatgggttaagcaaggccagtcaaattcaggc
gttgttcaagtacagcagaaagtcctgggtatcattccatcaagtacaggtaccagtcag
caaacctttacttcattccagcccaggacagcaacagtcacaattaggcccaatacctca
ggctctggaggaaccacaagcaattcacaagtaatcacagggcctcagattcgccctggt
atgaccgtgattagaacaccactccaacagtcaacactaggaaaggcaattattcgaaca
cctgtgatggtacagccaggtgctcctcagcaagtgatgactcaaatcatcagggggcag
cctgtctccactgcagtctccgcccctaacacggtttcctcaacacctgggcagaaaagc
ttaacttcagcaacgtccacttcaaatatacagtcttcagcctcacaaccccctcgcccc
caacaaggacaagtgaagctcaccatggctcaacttactcagttaacacagggccacggt
ggcaatcaaggtttgacagtagtaattcaaggacaaggtcaaactactggacagttgcag
ttgatacctcaaggggtgactgtactcccaggcccaggccagcagctaatgcaagctgca
atgccaaatggtactgttcagcgattcctctttaccccattggcaacaacagccaccaca
gccagcaccaccaccaccactgtttccacgacagcagcaggtacaggtgaacaaaggcag
agtaaactgtcaccccagatgcaggtacatcaagacaaaaccctgccaccagctcagtca
tcaagtgtgggtccagcagaagcccagccacagactgctcagccttcagctcagccccag
ccccaaacccagccccagtccccagctcagcctgaagttcagactcagcctgaagttcag
acccaaacaactgtttcatcccatgtcccttctgaagcacaacccacccacgcacagtca
tccaagccccaagttgcagcacagtctcagcctcaaagtaatgtccaaggacagtctcct
gttcgtgtccaaagtccatcacagactcgaatacgtccatcaactccatcccaactgtct
cctggacaacaatcccaggttcagactacaacctcacaaccgattccaattcaaccacat
acatctcttcagataccttcccaaggccagccacagtcacaaccccaggtacagtcttca
actcaaactctttcatcaggacaaactttaaatcaagttactgtttcatccccatcccgt
cctcagctacaaatacagcagccacagccccaagtcattgctgtgcctcagctgcaacaa
caagtccaggttctctctcagatccagtcacaggttgtggctcagatacaggctcagcaa
agtggtgtgccccagcaaatcaaactccagttacctatccaaattcagcaaagcagtgct
gtgcagactcaccagattcagaatgtggttacagtgcaggcagccagtgtgcaagagcag
ttgcaaagggttcagcaactcagggatcagcagcaaaagaagaaacagcaacagatagaa
attaagcgtgaacacaccctccaagcttctaatcaaagtgaaatcattcagaaacaggtg
gtgatgaagcataatgctgtaatagaacatttaaaacagaaaaagagcatgactccagct
gaaagagaagagaatcaaagaatgattgtctgtaaccaggtgatgaagtatattttggat
aagatagataaagaagaaaaacaggcagcaaaaaaacggaagcgtgaagagagtgtggag
cagaaacgtagcaagcagaatgccactaagctgtcagctctgctcttcaagcacaaagag
cagctcagagccgagatcctgaagaagagagcactcctggacaaggatctgcaaattgaa
gtgcaggaagagctgaagagagacctgaaaattaagaaagaaaaagacctgatgcagttg
gctcaggccacagcagtagctgcaccctgccccccagtgacaccagctcctccagcccct
ccagcccctccaccttcacctccccctccacctgctgtgcaacacacaggccttctgtcc
acgcccaccttacctgctgcttcccagaagaggaagcgggaagaggaaaaagactccagc
tcaaagtccaagaaaaagaaaatgatctctactacctcaaaggaaactaagaaggacaca
aagctttactgtatctgtaaaacgccttatgatgaatctaaattttatattggctgtgat
cggtgtcagaattggtaccatgggcgctgcgttggcatcttgcaaagtgaggcagagctc
attgatgagtatgtctgtccacagtgccagtcaacagaggatgccatgacagtgctcacg
ccactaacagagaaggattatgaggggttgaagagggtgctccgttccttacaggcccat
aagatggcctggcctttccttgaaccagtagaccctaatgatgcaccagattattatggt
gttattaaggaacctatggaccttgccaccatggaagaaagagtacaaagacgatattat
gaaaagctgacggaatttgtggcagatatgaccaaaatttttgataactgtcgttactac
aatccaagtgactccccattttaccagtgtgcagaagttctcgaatcattctttgtacag
aaattgaaaggcttcaaagctagcaggtctcataacaacaaactgcagtctacagcttct
taa

DBGET integrated database retrieval system