KEGG   Homo sapiens (human): 2194Help
Entry
2194              CDS       T01001                                 

Gene name
FASN, FAS, OA-519, SDR27X1
Definition
fatty acid synthase (EC:2.3.1.85 2.3.1.38 2.3.1.39 2.3.1.41 3.1.2.14 4.2.1.59 1.1.1.100 1.3.1.39)
Orthology
K00665  
fatty acid synthase, animal type [EC:2.3.1.85]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Fatty acid biosynthesis, elongation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:hsa00061]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 2511 aa AA seqDB search
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
SPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATL
PRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGP
EVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLS
TDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFE
FVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEA
QWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCT
IIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
AWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLA
RALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQ
WDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRL
LWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQVADVVV
SRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQL
CKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQ
VLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLL
SPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVA
ALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESL
FSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRP
VWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGD
LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGDLSSIRWVCSSLRHAQPTCPG
AQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAK
GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGV
GQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKG
VDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFF
NESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEE
PEAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGI
RTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLL
ENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSA
MERICEKRRHEGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN
QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSV
EVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLD
SIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGS
PTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAA
VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGA
DYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
NT seq 7536 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtggtgattgccggcatgtccgggaagctgccagagtcggagaacttgcag
gagttctgggacaacctcatcggcggtgtggacatggtcacggacgatgaccgtcgctgg
aaggcggggctctacggcctgccccggcggtccggcaagctgaaggacctgtctaggttt
gatgcctccttcttcggagtccaccccaagcaggcacacacgatggaccctcagctgcgg
ctgctgctggaagtcacctatgaagccatcgtggacggaggcatcaacccagattcactc
cgaggaacacacactggcgtctgggtgggcgtgagcggctctgagacctcggaggccctg
agccgagaccccgagacactcgtgggctacagcatggtgggctgccagcgagcgatgatg
gccaaccggctctccttcttcttcgacttcagagggcccagcatcgcactggacacagcc
tgctcctccagcctgatggccctgcagaacgcctaccaggccatccacagcgggcagtgc
cctgccgccatcgtggggggcatcaatgtcctgctgaagcccaacacctccgtgcagttc
ttgaggctggggatgctcagccccgagggcacctgcaaggccttcgacacagcggggaat
gggtactgccgctcggagggtgtggtggccgtcctgctgaccaagaagtccctggcccgg
cgggtgtacgccaccatcctgaacgccggcaccaatacagatggcttcaaggagcaaggc
gtgaccttcccctcaggggatatccaggagcagctcatccgctcgttgtaccagtcggcc
ggagtggcccctgagtcatttgaatacatcgaagcccacggcacaggcaccaaggtgggc
gacccccaggagctgaatggcatcacccgagccctgtgcgccacccgccaggagccgctg
ctcatcggctccaccaagtccaacatggggcacccggagccagcctcggggctggcagcc
ctggccaaggtgctgctgtccctggagcacgggctctgggcccccaacctgcacttccat
agccccaaccctgagatcccagcgctgttggatgggcggctgcaggtggtggaccagccc
ctgcccgtccgtggcggcaacgtgggcatcaactcctttggcttcgggggctccaacgtg
cacatcatcctgaggcccaacacgcagccgccccccgcacccgccccacatgccaccctg
ccccgtctgctgcgggccagcggacgcacccctgaggccgtgcagaagctgctggagcag
ggcctccggcacagccaggacctggctttcctgagcatgctgaacgacatcgcggctgtc
cccgccaccgccatgcccttccgtggctacgctgtgctgggtggtgagcgcggtggccca
gaggtgcagcaggtgcccgctggcgagcgcccgctctggttcatctgctctgggatgggc
acacagtggcgcgggatggggctgagcctcatgcgcctggaccgcttccgagattccatc
ctacgctccgatgaggctgtgaagccattcggcctgaaggtgtcacagctgctgctgagc
acagacgagagcacctttgatgacatcgtccattcgtttgtgagcctgactgccatccag
ataggcctcatagacctgctgagctgcatggggctgaggccagatggcatcgtcggccac
tccctgggggaggtggcctgtggctacgccgacggctgcctgtcccaggaggaggccgtc
ctcgctgcctactggaggggacagtgcatcaaagaagcccatctcccgccgggcgccatg
gcagccgtgggcttgtcctgggaggagtgtaaacagcgctgccccccgggcgtggtgccc
gcctgccacaactccaaggacacagtcaccatctcgggacctcaggccccggtgtttgag
ttcgtggagcagctgaggaaggagggtgtgtttgccaaggaggtgcggaccggcggtatg
gccttccactcctacttcatggaggccatcgcacccccactgctgcaggagctcaagaag
gtgatccgggagccgaagccacgttcagcccgctggctcagcacctctatccccgaggcc
cagtggcacagcagcctggcacgcacgtcctccgccgagtacaatgtcaacaacctggtg
agccctgtgctgttccaggaggccctgtggcacgtgcctgagcacgcggtggtgctggag
atcgcgccccacgccctgctgcaggctgtcctgaagcgtggcctgaagccgagctgcacc
atcatccccctgatgaagaaggatcacagggacaacctggagttcttcctggccggcatc
ggcaggctgcacctctcaggcatcgacgccaaccccaatgccttgttcccacctgtggag
ttcccagctccccgaggaactcccctcatctccccactcatcaagtgggaccacagcctg
gcctgggacgtgccggccgccgaggacttccccaacggttcaggttccccctcagccgcc
atctacaacatcgacaccagctccgagtctcctgaccactacctggtggaccacaccctc
gacggtcgcgtcctcttccccgccactggctacctgagcatagtgtggaagacgctggcc
cgcgccctgggcctgggcgtcgagcagctgcctgtggtgtttgaggatgtggtgctgcac
caggccaccatcctgcccaagactgggacagtgtccctggaggtacggctcctggaggcc
tcccgtgccttcgaggtgtcagagaacggcaacctggtagtgagtgggaaggtgtaccag
tgggatgaccctgaccccaggctcttcgaccacccggaaagccccacccccaaccccacg
gagcccctcttcctggcccaggctgaagtttacaaggagctgcgtctgcgtggctacgac
tacggccctcatttccagggcatcctggaggccagcctggaaggtgactcggggaggctg
ctgtggaaggataactgggtgagcttcatggacaccatgctgcagatgtccatcctgggc
tcggccaagcacggcctgtacctgcccacccgtgtcaccgccatccacatcgaccctgcc
acccacaggcagaagctgtacacactgcaggacaaggcccaagtggctgacgtggtggtg
agcaggtggctgagggtcacagtggccggaggcgtccacatctccgggctccacactgag
tcggccccgcggcggcagcaggagcagcaggtgcccatcctggagaagttttgcttcact
ccccacacggaggaggggtgcctgtctgagcgcgctgccctgcaggaggagctgcaactg
tgcaaggggctggtgcaggcactgcagaccaaggtgacccagcaggggctgaagatggtg
gtgcccggactggatggggcccagatcccccgggacccctcacagcaggaactgccccgg
ctgttgtcggctgcctgcaggcttcagctcaacgggaacctgcagctggagctggcgcag
gtgctggcccaggagaggcccaagctgccagaggaccctctgctcagcggcctcctggac
tccccggcactcaaggcctgcctggacactgccgtggagaacatgcccagcctgaagatg
aaggtggtggaggtgctggctggccacggtcacctgtattcccgcatcccaggcctgctc
agcccccatcccctgctgcagctgagctacacggccaccgaccgccacccccaggccctg
gaggctgcccaggccgagctgcagcagcacgacgttgcccagggccagtgggatcccgca
gaccctgcccccagcgccctgggcagcgccgacctcctggtgtgcaactgtgctgtggct
gccctcggggacccggcctcagctctcagcaacatggtggctgccctgagagaagggggc
tttctgctcctgcacacactgctccgggggcaccccctcggggacatcgtggccttcctc
acctccactgagccgcagtatggccagggcatcctgagccaggacgcgtgggagagcctc
ttctccagggtgtcgctgcgcctggtgggcctgaagaagtccttctacggctccacgctc
ttcctgtgccgccggcccaccccgcaggacagccccatcttcctgccggtggacgatacc
agcttccgctgggtggagtctctgaagggcatcctggctgacgaagactcttcccggcct
gtgtggctgaaggccatcaactgtgccacctcgggcgtggtgggcttggtgaactgtctc
cgccgagagcccggcgggaaccgcctccggtgtgtgctgctctccaacctcagcagcacc
tcccacgtcccggaggtggacccgggctccgcagaactgcagaaggtgttgcagggagac
ctggtgatgaacgtctaccgcgacggggcctggggggctttccgccacttcctgctggag
gaggacaagcctgaggagccgacggcacatgcctttgtgagcaccctcacccggggggac
ctgtcctccatccgctgggtctgctcctcgctgcgccatgcccagcccacctgccctggc
gcccagctctgcacggtctactacgcctccctcaacttccgcgacatcatgctggccact
ggcaagctgtcccctgatgccatcccagggaagtggacctcccaggacagcctgctaggt
atggagttctcgggccgagacgccagcggcaagcgtgtgatgggactggtgcctgccaag
ggcctggccacctctgtcctgctgtcaccggacttcctctgggatgtgccttccaactgg
acgctggaggaggcggcctcggtgcctgtcgtctacagcacggcctactacgcgctggtg
gtgcgtgggcgggtgcgccccggggagacgctgctcatccactcgggctcgggcggcgtg
ggccaggccgccatcgccatcgccctcagtctgggctgccgcgtcttcaccaccgtgggg
tcggctgagaagcgggcgtacctccaggccaggttcccccagctcgacagcaccagcttc
gccaactcccgggacacatccttcgagcagcatgtgctgtggcacacgggcgggaagggc
gttgacctggtcttgaactccttggcggaagagaagctgcaggccagcgtgaggtgcttg
gctacgcacggtcgcttcctggaaattggcaaattcgacctttctcagaaccacccgctc
ggcatggctatcttcctgaagaacgtgacattccacggggtcctactggatgcgttcttc
aacgagagcagtgctgactggcgggaggtgtgggcgcttgtgcaggccggcatccgggat
ggggtggtacggcccctcaagtgcacggtgttccatggggcccaggtggaggacgccttc
cgctacatggcccaagggaagcacattggcaaagtcgtcgtgcaggtgcttgcggaggag
ccggaggcagtgctgaagggggccaaacccaagctgatgtcggccatctccaagaccttc
tgcccggcccacaagagctacatcatcgctggtggtctgggtggcttcggcctggagttg
gcgcagtggctgatacagcgtggggtgcagaagctcgtgttgacttctcgctccgggatc
cggacaggctaccaggccaagcaggtccgccggtggaggcgccagggcgtacaggtgcag
gtgtccaccagcaacatcagctcactggagggggcccggggcctcattgccgaggcggcg
cagcttgggcccgtgggcggcgtcttcaacctggccgtggtcttgagagatggcttgctg
gagaaccagaccccagagttcttccaggacgtctgcaagcccaagtacagcggcaccctg
aacctggacagggtgacccgagaggcgtgccctgagctggactactttgtggtcttctcc
tctgtgagctgcgggcgtggcaatgcgggacagagcaactacggctttgccaattccgcc
atggagcgtatctgtgagaaacgccggcacgaaggcctcccaggcctggccgtgcagtgg
ggcgccatcggcgacgtgggcattttggtggagacgatgagcaccaacgacacgatcgtc
agtggcacgctgccccagcgcatggcgtcctgcctggaggtgctggacctcttcctgaac
cagccccacatggtcctgagcagctttgtgctggctgagaaggctgcggcctatagggac
agggacagccagcgggacctggtggaggccgtggcacacatcctgggcatccgcgacttg
gctgctgtcaacctggacagctcactggcggacctgggcctggactcgctcatgagcgtg
gaggtgcgccagacgctggagcgtgagctcaacctggtgctgtccgtgcgcgaggtgcgg
caactcacgctccggaaactgcaggagctgtcctcaaaggcggatgaggccagcgagctg
gcatgccccacgcccaaggaggatggtctggcccagcagcagactcagctgaacctgcgc
tccctgctggtgaacccggagggccccaccctgatgcggctcaactccgtgcagagctcg
gagcggcccctgttcctggtgcacccaatcgagggctccaccaccgtgttccacagcctg
gcctcccggctcagcatccccacctatggcctgcagtgcacccgagctgcgccccttgac
agcatccacagcctggctgcctactacatcgactgcatcaggcaggtgcagcccgagggc
ccctaccgcgtggccggctactcctacggggcctgcgtggcctttgaaatgtgctcccag
ctgcaggcccagcagagcccagcccccacccacaacagcctcttcctgttcgacggctcg
cccacctacgtactggcctacacccagagctaccgggcaaagctgaccccaggctgtgag
gctgaggctgagacggaggccatatgcttcttcgtgcagcagttcacggacatggagcac
aacagggtgctggaggcgctgctgccgctgaagggcctagaggagcgtgtggcagccgcc
gtggacctgatcatcaagagccaccagggcctggaccgccaggagctgagctttgcggcc
cggtccttctactacaagctgcgtgccgctgagcagtacacacccaaggccaagtaccat
ggcaacgtgatgctactgcgcgccaagacgggtggcgcctacggcgaggacctgggcgcg
gactacaacctctcccaggtatgcgacgggaaagtatccgtccacgtcatcgagggtgac
caccgcacgctgctggagggcagcggcctggagtccatcatcagcatcatccacagctcc
ctggctgagccacgcgtgagcgtgcgggagggctag

DBGET integrated database retrieval system