KEGG   Homo sapiens (human): 2194Help
Entry
2194              CDS       T01001                                 

Gene name
FASN, FAS, OA-519, SDR27X1
Definition
fatty acid synthase (EC:2.3.1.85 2.3.1.38 2.3.1.39 2.3.1.41 3.1.2.14 4.2.1.59 1.1.1.100 1.3.1.39)
Orthology
K00665  
fatty acid synthase, animal type [EC:2.3.1.85]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid biosynthesis
Metabolic pathways
Fatty acid metabolism
AMPK signaling pathway
Insulin signaling pathway
Module
Fatty acid biosynthesis, initiation
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    2194 (FASN)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    2194 (FASN)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    2194 (FASN)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    2194 (FASN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase
     2194 (FASN)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Animal type
   2194 (FASN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2194 (FASN)
  Exosomal proteins of breast milk
   2194 (FASN)
  Exosomal proteins of colorectal cancer cells
   2194 (FASN)
  Exosomal proteins of bladder cancer cells
   2194 (FASN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25
AA seq 2511 aa AA seqDB search
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSETSEAL
SRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAIHSGQC
PAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHGTGTKVG
DPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
SPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAPAPHATL
PRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVLGGERGGP
EVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQLLLS
TDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADGCLSQEEAV
LAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAPVFE
FVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRSARWLSTSIPEA
QWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLKRGLKPSCT
IIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDHSL
AWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATGYLSIVWKTLA
RALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSENGNLVVSGKVYQ
WDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYDYGPHFQGILEASLEGDSGRL
LWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKLYTLQDKAQVADVVV
SRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQL
CKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGNLQLELAQ
VLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMKVVEVLAGHGHLYSRIPGLL
SPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDPADPAPSALGSADLLVCNCAVA
ALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIVAFLTSTEPQYGQGILSQDAWESL
FSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVDDTSFRWVESLKGILADEDSSRP
VWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNLSSTSHVPEVDPGSAELQKVLQGD
LVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVSTLTRGDLSSIRWVCSSLRHAQPTCPG
AQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTSQDSLLGMEFSGRDASGKRVMGLVPAK
GLATSVLLSPDFLWDVPSNWTLEEAASVPVVYSTAYYALVVRGRVRPGETLLIHSGSGGV
GQAAIAIALSLGCRVFTTVGSAEKRAYLQARFPQLDSTSFANSRDTSFEQHVLWHTGGKG
VDLVLNSLAEEKLQASVRCLATHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGVLLDAFF
NESSADWREVWALVQAGIRDGVVRPLKCTVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEE
PEAVLKGAKPKLMSAISKTFCPAHKSYIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGI
RTGYQAKQVRRWRRQGVQVQVSTSNISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLL
ENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSA
MERICEKRRHEGLPGLAVQWGAIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLN
QPHMVLSSFVLAEKAAAYRDRDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSV
EVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR
SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLD
SIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGS
PTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAA
VDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGA
DYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
NT seq 7536 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggtggtgattgccggcatgtccgggaagctgccagagtcggagaacttgcag
gagttctgggacaacctcatcggcggtgtggacatggtcacggacgatgaccgtcgctgg
aaggcggggctctacggcctgccccggcggtccggcaagctgaaggacctgtctaggttt
gatgcctccttcttcggagtccaccccaagcaggcacacacgatggaccctcagctgcgg
ctgctgctggaagtcacctatgaagccatcgtggacggaggcatcaacccagattcactc
cgaggaacacacactggcgtctgggtgggcgtgagcggctctgagacctcggaggccctg
agccgagaccccgagacactcgtgggctacagcatggtgggctgccagcgagcgatgatg
gccaaccggctctccttcttcttcgacttcagagggcccagcatcgcactggacacagcc
tgctcctccagcctgatggccctgcagaacgcctaccaggccatccacagcgggcagtgc
cctgccgccatcgtggggggcatcaatgtcctgctgaagcccaacacctccgtgcagttc
ttgaggctggggatgctcagccccgagggcacctgcaaggccttcgacacagcggggaat
gggtactgccgctcggagggtgtggtggccgtcctgctgaccaagaagtccctggcccgg
cgggtgtacgccaccatcctgaacgccggcaccaatacagatggcttcaaggagcaaggc
gtgaccttcccctcaggggatatccaggagcagctcatccgctcgttgtaccagtcggcc
ggagtggcccctgagtcatttgaatacatcgaagcccacggcacaggcaccaaggtgggc
gacccccaggagctgaatggcatcacccgagccctgtgcgccacccgccaggagccgctg
ctcatcggctccaccaagtccaacatggggcacccggagccagcctcggggctggcagcc
ctggccaaggtgctgctgtccctggagcacgggctctgggcccccaacctgcacttccat
agccccaaccctgagatcccagcgctgttggatgggcggctgcaggtggtggaccagccc
ctgcccgtccgtggcggcaacgtgggcatcaactcctttggcttcgggggctccaacgtg
cacatcatcctgaggcccaacacgcagccgccccccgcacccgccccacatgccaccctg
ccccgtctgctgcgggccagcggacgcacccctgaggccgtgcagaagctgctggagcag
ggcctccggcacagccaggacctggctttcctgagcatgctgaacgacatcgcggctgtc
cccgccaccgccatgcccttccgtggctacgctgtgctgggtggtgagcgcggtggccca
gaggtgcagcaggtgcccgctggcgagcgcccgctctggttcatctgctctgggatgggc
acacagtggcgcgggatggggctgagcctcatgcgcctggaccgcttccgagattccatc
ctacgctccgatgaggctgtgaagccattcggcctgaaggtgtcacagctgctgctgagc
acagacgagagcacctttgatgacatcgtccattcgtttgtgagcctgactgccatccag
ataggcctcatagacctgctgagctgcatggggctgaggccagatggcatcgtcggccac
tccctgggggaggtggcctgtggctacgccgacggctgcctgtcccaggaggaggccgtc
ctcgctgcctactggaggggacagtgcatcaaagaagcccatctcccgccgggcgccatg
gcagccgtgggcttgtcctgggaggagtgtaaacagcgctgccccccgggcgtggtgccc
gcctgccacaactccaaggacacagtcaccatctcgggacctcaggccccggtgtttgag
ttcgtggagcagctgaggaaggagggtgtgtttgccaaggaggtgcggaccggcggtatg
gccttccactcctacttcatggaggccatcgcacccccactgctgcaggagctcaagaag
gtgatccgggagccgaagccacgttcagcccgctggctcagcacctctatccccgaggcc
cagtggcacagcagcctggcacgcacgtcctccgccgagtacaatgtcaacaacctggtg
agccctgtgctgttccaggaggccctgtggcacgtgcctgagcacgcggtggtgctggag
atcgcgccccacgccctgctgcaggctgtcctgaagcgtggcctgaagccgagctgcacc
atcatccccctgatgaagaaggatcacagggacaacctggagttcttcctggccggcatc
ggcaggctgcacctctcaggcatcgacgccaaccccaatgccttgttcccacctgtggag
ttcccagctccccgaggaactcccctcatctccccactcatcaagtgggaccacagcctg
gcctgggacgtgccggccgccgaggacttccccaacggttcaggttccccctcagccgcc
atctacaacatcgacaccagctccgagtctcctgaccactacctggtggaccacaccctc
gacggtcgcgtcctcttccccgccactggctacctgagcatagtgtggaagacgctggcc
cgcgccctgggcctgggcgtcgagcagctgcctgtggtgtttgaggatgtggtgctgcac
caggccaccatcctgcccaagactgggacagtgtccctggaggtacggctcctggaggcc
tcccgtgccttcgaggtgtcagagaacggcaacctggtagtgagtgggaaggtgtaccag
tgggatgaccctgaccccaggctcttcgaccacccggaaagccccacccccaaccccacg
gagcccctcttcctggcccaggctgaagtttacaaggagctgcgtctgcgtggctacgac
tacggccctcatttccagggcatcctggaggccagcctggaaggtgactcggggaggctg
ctgtggaaggataactgggtgagcttcatggacaccatgctgcagatgtccatcctgggc
tcggccaagcacggcctgtacctgcccacccgtgtcaccgccatccacatcgaccctgcc
acccacaggcagaagctgtacacactgcaggacaaggcccaagtggctgacgtggtggtg
agcaggtggctgagggtcacagtggccggaggcgtccacatctccgggctccacactgag
tcggccccgcggcggcagcaggagcagcaggtgcccatcctggagaagttttgcttcact
ccccacacggaggaggggtgcctgtctgagcgcgctgccctgcaggaggagctgcaactg
tgcaaggggctggtgcaggcactgcagaccaaggtgacccagcaggggctgaagatggtg
gtgcccggactggatggggcccagatcccccgggacccctcacagcaggaactgccccgg
ctgttgtcggctgcctgcaggcttcagctcaacgggaacctgcagctggagctggcgcag
gtgctggcccaggagaggcccaagctgccagaggaccctctgctcagcggcctcctggac
tccccggcactcaaggcctgcctggacactgccgtggagaacatgcccagcctgaagatg
aaggtggtggaggtgctggctggccacggtcacctgtattcccgcatcccaggcctgctc
agcccccatcccctgctgcagctgagctacacggccaccgaccgccacccccaggccctg
gaggctgcccaggccgagctgcagcagcacgacgttgcccagggccagtgggatcccgca
gaccctgcccccagcgccctgggcagcgccgacctcctggtgtgcaactgtgctgtggct
gccctcggggacccggcctcagctctcagcaacatggtggctgccctgagagaagggggc
tttctgctcctgcacacactgctccgggggcaccccctcggggacatcgtggccttcctc
acctccactgagccgcagtatggccagggcatcctgagccaggacgcgtgggagagcctc
ttctccagggtgtcgctgcgcctggtgggcctgaagaagtccttctacggctccacgctc
ttcctgtgccgccggcccaccccgcaggacagccccatcttcctgccggtggacgatacc
agcttccgctgggtggagtctctgaagggcatcctggctgacgaagactcttcccggcct
gtgtggctgaaggccatcaactgtgccacctcgggcgtggtgggcttggtgaactgtctc
cgccgagagcccggcgggaaccgcctccggtgtgtgctgctctccaacctcagcagcacc
tcccacgtcccggaggtggacccgggctccgcagaactgcagaaggtgttgcagggagac
ctggtgatgaacgtctaccgcgacggggcctggggggctttccgccacttcctgctggag
gaggacaagcctgaggagccgacggcacatgcctttgtgagcaccctcacccggggggac
ctgtcctccatccgctgggtctgctcctcgctgcgccatgcccagcccacctgccctggc
gcccagctctgcacggtctactacgcctccctcaacttccgcgacatcatgctggccact
ggcaagctgtcccctgatgccatcccagggaagtggacctcccaggacagcctgctaggt
atggagttctcgggccgagacgccagcggcaagcgtgtgatgggactggtgcctgccaag
ggcctggccacctctgtcctgctgtcaccggacttcctctgggatgtgccttccaactgg
acgctggaggaggcggcctcggtgcctgtcgtctacagcacggcctactacgcgctggtg
gtgcgtgggcgggtgcgccccggggagacgctgctcatccactcgggctcgggcggcgtg
ggccaggccgccatcgccatcgccctcagtctgggctgccgcgtcttcaccaccgtgggg
tcggctgagaagcgggcgtacctccaggccaggttcccccagctcgacagcaccagcttc
gccaactcccgggacacatccttcgagcagcatgtgctgtggcacacgggcgggaagggc
gttgacctggtcttgaactccttggcggaagagaagctgcaggccagcgtgaggtgcttg
gctacgcacggtcgcttcctggaaattggcaaattcgacctttctcagaaccacccgctc
ggcatggctatcttcctgaagaacgtgacattccacggggtcctactggatgcgttcttc
aacgagagcagtgctgactggcgggaggtgtgggcgcttgtgcaggccggcatccgggat
ggggtggtacggcccctcaagtgcacggtgttccatggggcccaggtggaggacgccttc
cgctacatggcccaagggaagcacattggcaaagtcgtcgtgcaggtgcttgcggaggag
ccggaggcagtgctgaagggggccaaacccaagctgatgtcggccatctccaagaccttc
tgcccggcccacaagagctacatcatcgctggtggtctgggtggcttcggcctggagttg
gcgcagtggctgatacagcgtggggtgcagaagctcgtgttgacttctcgctccgggatc
cggacaggctaccaggccaagcaggtccgccggtggaggcgccagggcgtacaggtgcag
gtgtccaccagcaacatcagctcactggagggggcccggggcctcattgccgaggcggcg
cagcttgggcccgtgggcggcgtcttcaacctggccgtggtcttgagagatggcttgctg
gagaaccagaccccagagttcttccaggacgtctgcaagcccaagtacagcggcaccctg
aacctggacagggtgacccgagaggcgtgccctgagctggactactttgtggtcttctcc
tctgtgagctgcgggcgtggcaatgcgggacagagcaactacggctttgccaattccgcc
atggagcgtatctgtgagaaacgccggcacgaaggcctcccaggcctggccgtgcagtgg
ggcgccatcggcgacgtgggcattttggtggagacgatgagcaccaacgacacgatcgtc
agtggcacgctgccccagcgcatggcgtcctgcctggaggtgctggacctcttcctgaac
cagccccacatggtcctgagcagctttgtgctggctgagaaggctgcggcctatagggac
agggacagccagcgggacctggtggaggccgtggcacacatcctgggcatccgcgacttg
gctgctgtcaacctggacagctcactggcggacctgggcctggactcgctcatgagcgtg
gaggtgcgccagacgctggagcgtgagctcaacctggtgctgtccgtgcgcgaggtgcgg
caactcacgctccggaaactgcaggagctgtcctcaaaggcggatgaggccagcgagctg
gcatgccccacgcccaaggaggatggtctggcccagcagcagactcagctgaacctgcgc
tccctgctggtgaacccggagggccccaccctgatgcggctcaactccgtgcagagctcg
gagcggcccctgttcctggtgcacccaatcgagggctccaccaccgtgttccacagcctg
gcctcccggctcagcatccccacctatggcctgcagtgcacccgagctgcgccccttgac
agcatccacagcctggctgcctactacatcgactgcatcaggcaggtgcagcccgagggc
ccctaccgcgtggccggctactcctacggggcctgcgtggcctttgaaatgtgctcccag
ctgcaggcccagcagagcccagcccccacccacaacagcctcttcctgttcgacggctcg
cccacctacgtactggcctacacccagagctaccgggcaaagctgaccccaggctgtgag
gctgaggctgagacggaggccatatgcttcttcgtgcagcagttcacggacatggagcac
aacagggtgctggaggcgctgctgccgctgaagggcctagaggagcgtgtggcagccgcc
gtggacctgatcatcaagagccaccagggcctggaccgccaggagctgagctttgcggcc
cggtccttctactacaagctgcgtgccgctgagcagtacacacccaaggccaagtaccat
ggcaacgtgatgctactgcgcgccaagacgggtggcgcctacggcgaggacctgggcgcg
gactacaacctctcccaggtatgcgacgggaaagtatccgtccacgtcatcgagggtgac
caccgcacgctgctggagggcagcggcctggagtccatcatcagcatcatccacagctcc
ctggctgagccacgcgtgagcgtgcgggagggctag

DBGET integrated database retrieval system