KEGG   Homo sapiens (human): 219931Help
Entry
219931            CDS       T01001                                 

Gene name
TPCN2, SHEP10, TPC2
Definition
two pore segment channel 2
Orthology
K14077  
two pore calcium channel protein 2
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    219931 (TPCN2)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  CatSper and two-pore channel
   219931 (TPCN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
11q13.3
AA seq 752 aa AA seqDB search
MAEPQAESEPLLGGARGGGGDWPAGLTTYRSIQVGPGAAARWDLCIDQAVVFIEDAIQYR
SINHRVDASSMWLYRRYYSNVCQRTLSFTIFLILFLAFIETPSSLTSTADVRYRAAPWEP
PCGLTESVEVLCLLVFAADLSVKGYLFGWAHFQKNLWLLGYLVVLVVSLVDWTVSLSLVC
HEPLRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTMFGMLLFAG
GKQDDGQDRERLTYFQNLPESLTSLLVLLTTANNPDVMIPAYSKNRAYAIFFIVFTVIGS
LFLMNLLTAIIYSQFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQ
NLLQVLQKVQLDSSHKQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSP
FLQSAQFLFGHYYFDYLGNLIALANLVSICVFLVLDADVLPAERDDFILGILNCVFIVYY
LLEMLLKVFALGLRGYLSYPSNVFDGLLTVVLLVLEISTLAVYRLPHPGWRPEMVGLLSL
WDMTRMLNMLIVFRFLRIIPSMKLMAVVASTVLGLVQNMRAFGGILVVVYYVFAIIGINL
FRGVIVALPGNSSLAPANGSAPCGSFEQLEYWANNFDDFAAALVTLWNLMVVNNWQVFLD
AYRRYSGPWSKIYFVLWWLVSSVIWVNLFLALILENFLHKWDPRSHLQPLAGTPEATYQM
TVELLFRDILEEPGEDELTERLSQHPHLWLCR
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccccaggcggagtcggagcccctgctgggcggggcccgcggcggtggcggc
gactggccggcggggctgaccacttaccgcagcatccaagtcggccctggtgccgcggcc
aggtgggacctctgcattgatcaggctgtggtcttcatcgaagatgctattcagtaccgc
tccatcaaccaccgggtggatgccagctcgatgtggctttaccgacggtattactcgaac
gtatgccaacggactttgagcttcaccatcttcttgatcctgtttttggcttttatcgag
accccatcctcactcaccagcacggcggacgtgcgctaccgcgctgccccctgggagccg
ccctgcggcctgaccgagagtgtcgaggtgctctgcctgctggtctttgcggccgacctc
tctgtgaagggttacctgttcgggtgggcccatttccagaaaaacctttggctgctgggc
tacctcgtggtgctggtggtgtctctggtggactggaccgtgtccctgagtctcgtgtgt
catgagcccctgcggatccgccggcttctccgtcccttcttcctgctgcagaactcctct
atgatgaagaagaccttgaaatgcatccgctggtcgctgccggaaatggccagcgtcggg
ctgctgctggccatccacctgtgcctcttcaccatgttcggaatgctgctgttcgctggt
gggaagcaggatgatgggcaggacagggagaggctgacctacttccagaacctgcctgag
tctctgacttccctcctggtgctgctgaccacggccaacaaccccgatgtgatgattcct
gcgtattccaagaaccgggcctatgccatcttcttcatagtcttcactgtgataggaagc
ctgtttctgatgaacctgctgacagccatcatctacagtcagttccggggctacctgatg
aaatctctccagacctcgctgtttcggaggcggctgggaacccgggctgcctttgaagtc
ctatcctccatggtgggggagggaggagccttccctcaggcagttggggtgaagccccag
aacttgctgcaggtgcttcagaaggtccagctggacagctcccacaaacaggccatgatg
gagaaggtgcgttcctatggcagtgttctgctctcagctgaggagtttcagaagctcttc
aacgagcttgacagaagtgtggttaaagagcacccgccgaggcccgagtaccagtctccg
tttctgcagagcgcccagttcctcttcggccactactactttgactacctggggaacctc
atcgccctggcaaacctggtgtccatttgcgtgttcctggtgctggatgcagatgtgctg
cctgctgagcgtgatgacttcatcctggggattctcaactgcgtcttcattgtgtactac
ctgttggagatgctgctcaaggtctttgccctgggcctgcgagggtacctgtcctacccc
agcaacgtgtttgacgggctcctcaccgttgtcctgctggttttggagatctcaactctg
gctgtgtaccgattgccacacccaggctggaggccggagatggtgggcctgctgtcgctg
tgggacatgacccgcatgctgaacatgctcatcgtgttccgcttcctgcgtatcatcccc
agcatgaagctgatggccgtggtggccagtaccgtcctgggcctggtgcagaacatgcgt
gcgtttggcgggatcctggtggtggtctactacgtatttgccatcattgggatcaacttg
tttagaggcgtcattgtggctcttcctggaaacagcagcctggcccctgccaatggctcg
gcgccctgtgggagcttcgagcagctggagtactgggccaacaacttcgatgactttgcg
gctgccctggtcactctgtggaacttgatggtggtgaacaactggcaggtgtttctggat
gcatatcggcgctactcaggcccgtggtccaagatctattttgtattgtggtggctggtg
tcgtctgtcatctgggtcaacctgtttctggccctgattctggagaacttccttcacaag
tgggacccccgcagccacctgcagccccttgctgggaccccagaggccacctaccagatg
actgtggagctcctgttcagggatattctggaggagcccggggaggatgagctcacagag
aggctgagccagcacccgcacctgtggctgtgcaggtga

DBGET integrated database retrieval system