KEGG   Homo sapiens (human): 2208Help
Entry
2208              CDS       T01001                                 

Gene name
FCER2, BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF
Definition
Fc fragment of IgE, low affinity II, receptor for (CD23)
Orthology
K06468  
Fc receptor, IgE, low affinity II
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Epstein-Barr virus infection
Drug target
Other: 
Class
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 320 aa AA seqDB search
MNPPSQEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAA
RNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLS
SFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT
KQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVD
YSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMG
PDSRPDPDGRLPTPSAPLHS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctccaagccaggagatcgaggagcttcccaggaggcggtgttgcaggcgtggg
actcagatcgtgctgctggggctggtgaccgccgctctgtgggctgggctgctgactctg
cttctcctgtggcactgggacaccacacagagtctaaaacagctggaagagagggctgcc
cggaacgtctctcaagtttccaagaacttggaaagccaccacggtgaccagatggcgcag
aaatcccagtccacgcagatttcacaggaactggaggaacttcgagctgaacagcagaga
ttgaaatctcaggacttggagctgtcctggaacctgaacgggcttcaagcagatctgagc
agcttcaagtcccaggaattgaacgagaggaacgaagcttcagatttgctggaaagactc
cgggaggaggtgacaaagctaaggatggagttgcaggtgtccagcggctttgtgtgcaac
acgtgccctgaaaagtggatcaatttccaacggaagtgctactacttcggcaagggcacc
aagcagtgggtccacgcccggtatgcctgtgacgacatggaagggcagctggtcagcatc
cacagcccggaggagcaggacttcctgaccaagcatgccagccacaccggctcctggatt
ggccttcggaacttggacctgaagggggagtttatctgggtggatgggagccacgtggac
tacagcaactgggctccaggggagcccaccagccggagccagggcgaggactgcgtgatg
atgcggggctccggtcgctggaacgacgccttctgcgaccgtaagctgggcgcctgggtg
tgcgaccggctggccacatgcacgccgccagccagcgaaggttccgcggagtccatggga
cctgattcaagaccagaccctgacggccgcctgcccaccccctctgcccctctccactct
tga

DBGET integrated database retrieval system