KEGG   Homo sapiens (human): 2208Help
Entry
2208              CDS       T01001                                 

Gene name
FCER2, BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF
Definition
(RefSeq) Fc fragment of IgE, low affinity II, receptor for (CD23)
  KO
K06468  
Fc receptor, IgE, low affinity II
Organism
hsa  Homo sapiens (human)
Pathway
Hematopoietic cell lineage
Epstein-Barr virus infection
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    2208 (FCER2)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    2208 (FCER2)
Cellular antigens [BR:hsa04090]
 Proteins
  2208 (FCER2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    2208 (FCER2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 320 aa AA seqDB search
MNPPSQEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAA
RNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLS
SFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT
KQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVD
YSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMG
PDSRPDPDGRLPTPSAPLHS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctccaagccaggagatcgaggagcttcccaggaggcggtgttgcaggcgtggg
actcagatcgtgctgctggggctggtgaccgccgctctgtgggctgggctgctgactctg
cttctcctgtggcactgggacaccacacagagtctaaaacagctggaagagagggctgcc
cggaacgtctctcaagtttccaagaacttggaaagccaccacggtgaccagatggcgcag
aaatcccagtccacgcagatttcacaggaactggaggaacttcgagctgaacagcagaga
ttgaaatctcaggacttggagctgtcctggaacctgaacgggcttcaagcagatctgagc
agcttcaagtcccaggaattgaacgagaggaacgaagcttcagatttgctggaaagactc
cgggaggaggtgacaaagctaaggatggagttgcaggtgtccagcggctttgtgtgcaac
acgtgccctgaaaagtggatcaatttccaacggaagtgctactacttcggcaagggcacc
aagcagtgggtccacgcccggtatgcctgtgacgacatggaagggcagctggtcagcatc
cacagcccggaggagcaggacttcctgaccaagcatgccagccacaccggctcctggatt
ggccttcggaacttggacctgaagggggagtttatctgggtggatgggagccacgtggac
tacagcaactgggctccaggggagcccaccagccggagccagggcgaggactgcgtgatg
atgcggggctccggtcgctggaacgacgccttctgcgaccgtaagctgggcgcctgggtg
tgcgaccggctggccacatgcacgccgccagccagcgaaggttccgcggagtccatggga
cctgattcaagaccagaccctgacggccgcctgcccaccccctctgcccctctccactct
tga

DBGET integrated database retrieval system