KEGG   Homo sapiens (human): 2213Help
Entry
2213              CDS       T01001                                 

Gene name
FCGR2B, CD32, CD32B, FCG2, FCGR2, IGFR2
Definition
Fc fragment of IgG, low affinity IIb, receptor (CD32)
Orthology
K12560  
low affinity immunoglobulin gamma Fc region receptor II-b
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles
Disease
H00080  
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    2213 (FCGR2B)
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    2213 (FCGR2B)
   04666 Fc gamma R-mediated phagocytosis
    2213 (FCGR2B)
  Development
   04380 Osteoclast differentiation
    2213 (FCGR2B)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    2213 (FCGR2B)
   05152 Tuberculosis
    2213 (FCGR2B)
   05162 Measles
    2213 (FCGR2B)
Cellular antigens [BR:hsa04090]
 Proteins
  2213 (FCGR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 290 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAPPKAVLKLEPQWINV
LQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLS
DPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNF
SIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAV
VALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgctcccccaaaggctgtgctgaaactcgagccccagtggatcaacgtg
ctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagcgactcc
attcagtggttccacaatgggaatctcattcccacccacacgcagcccagctacaggttc
aaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctcagc
gaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctggag
ttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctggtc
aaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaacttc
tccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacataggc
tacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttcaccg
atggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgctgta
gtggccttgatctactgcaggaaaaagcggatttcagccaatcccactaatcctgatgag
gctgacaaagttggggctgagaacacaatcacctattcacttctcatgcacccggatgct
ctggaagagcctgatgaccagaaccgtatttag

DBGET integrated database retrieval system