KEGG   Homo sapiens (human): 2213Help
Entry
2213              CDS       T01001                                 

Gene name
FCGR2B, CD32, CD32B, FCG2, FCGR2, IGFR2
Definition
Fc fragment of IgG, low affinity IIb, receptor (CD32)
Orthology
K12560  
low affinity immunoglobulin gamma Fc region receptor II-b
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles
Disease
H00080  
Systemic lupus erythematosus
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Immune system; B cell receptor signaling pathway [PATH:hsa04662]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Measles [PATH:hsa05162]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23
AA seq 290 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAPPKAVLKLEPQWINV
LQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLS
DPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNF
SIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAAV
VALIYCRKKRISANPTNPDEADKVGAENTITYSLLMHPDALEEPDDQNRI
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgctcccccaaaggctgtgctgaaactcgagccccagtggatcaacgtg
ctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagcgactcc
attcagtggttccacaatgggaatctcattcccacccacacgcagcccagctacaggttc
aaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctcagc
gaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctggag
ttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctggtc
aaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaacttc
tccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacataggc
tacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttcaccg
atggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgctgta
gtggccttgatctactgcaggaaaaagcggatttcagccaatcccactaatcctgatgag
gctgacaaagttggggctgagaacacaatcacctattcacttctcatgcacccggatgct
ctggaagagcctgatgaccagaaccgtatttag

DBGET integrated database retrieval system