KEGG   Homo sapiens (human): 2213Help
Entry
2213              CDS       T01001                                 

Gene name
FCGR2B, CD32, CD32B, FCG2, FCGR2, IGFR2
Definition
(RefSeq) Fc fragment of IgG receptor IIb
  KO
K12560  
low affinity immunoglobulin gamma Fc receptor II-b
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles
Disease
H00080  
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    2213 (FCGR2B)
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    2213 (FCGR2B)
   04666 Fc gamma R-mediated phagocytosis
    2213 (FCGR2B)
  Development
   04380 Osteoclast differentiation
    2213 (FCGR2B)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    2213 (FCGR2B)
   05152 Tuberculosis
    2213 (FCGR2B)
   05162 Measles
    2213 (FCGR2B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2213 (FCGR2B)
Cellular antigens [BR:hsa04090]
 Proteins
  2213 (FCGR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 310 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattcagtggttccacaatgggaatctcattcccacccacacgcagcccagctacagg
ttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctc
agcgaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctg
gagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctg
gtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaac
ttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacata
ggctacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttca
ccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgct
gtagtggccttgatctactgcaggaaaaagcggatttcagctctcccaggataccctgag
tgcagggaaatgggagagaccctccctgagaaaccagccaatcccactaatcctgatgag
gctgacaaagttggggctgagaacacaatcacctattcacttctcatgcacccggatgct
ctggaagagcctgatgaccagaaccgtatttag

DBGET integrated database retrieval system