KEGG   Homo sapiens (human): 2215Help
Entry
2215              CDS       T01001                                 

Gene name
FCGR3B, CD16, CD16b, FCG3, FCGR3, FCR-10, FCRIII, FCRIIIb
Definition
(RefSeq) Fc fragment of IgG receptor IIIb
  KO
K06463  
low affinity immunoglobulin gamma Fc receptor III
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Systemic lupus erythematosus
Disease
H00080  
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    2215 (FCGR3B)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    2215 (FCGR3B)
  Development
   04380 Osteoclast differentiation
    2215 (FCGR3B)
 Human Diseases
  Immune diseases
   05322 Systemic lupus erythematosus
    2215 (FCGR3B)
  Infectious diseases
   05150 Staphylococcus aureus infection
    2215 (FCGR3B)
   05152 Tuberculosis
    2215 (FCGR3B)
   05140 Leishmaniasis
    2215 (FCGR3B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2215 (FCGR3B)
CD molecules [BR:hsa04090]
 Proteins
  2215 (FCGR3B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2215 (FCGR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75015(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.3
AA seq 233 aa AA seqDB search
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQW
FHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKN
VSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctgctcctcccaactgctctgctacttctagtttcagctggcatgcggact
gaagatctcccaaaggctgtggtgttcctggagcctcaatggtacagcgtgcttgagaag
gacagtgtgactctgaagtgccagggagcctactcccctgaggacaattccacacagtgg
tttcacaatgagaacctcatctcaagccaggcctcgagctacttcattgacgctgccaca
gtcaacgacagtggagagtacaggtgccagacaaacctctccaccctcagtgacccggtg
cagctagaagtccatatcggctggctgttgctccaggcccctcggtgggtgttcaaggag
gaagaccctattcacctgaggtgtcacagctggaagaacactgctctgcataaggtcaca
tatttacagaatggcaaagacaggaagtattttcatcataattctgacttccacattcca
aaagccacactcaaagatagcggctcctacttctgcagggggcttgttgggagtaaaaat
gtgtcttcagagactgtgaacatcaccatcactcaaggtttggcagtgtcaaccatctca
tcattctctccacctgggtaccaagtctctttctgcttggtgatggtactcctttttgca
gtggacacaggactatatttctctgtgaagacaaacatttga

DBGET integrated database retrieval system