KEGG   Homo sapiens (human): 223Help
Entry
223               CDS       T01001                                 

Gene name
ALDH9A1, ALDH4, ALDH7, ALDH9, E3, TMABADH
Definition
aldehyde dehydrogenase 9 family, member A1 (EC:1.2.1.3 1.2.1.19 1.2.1.47)
Orthology
K00149  
aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    223 (ALDH9A1)
   00053 Ascorbate and aldarate metabolism
    223 (ALDH9A1)
   00620 Pyruvate metabolism
    223 (ALDH9A1)
   00640 Propanoate metabolism
    223 (ALDH9A1)
  Lipid metabolism
   00071 Fatty acid degradation
    223 (ALDH9A1)
   00561 Glycerolipid metabolism
    223 (ALDH9A1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    223 (ALDH9A1)
   00310 Lysine degradation
    223 (ALDH9A1)
   00330 Arginine and proline metabolism
    223 (ALDH9A1)
   00340 Histidine metabolism
    223 (ALDH9A1)
   00380 Tryptophan metabolism
    223 (ALDH9A1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    223 (ALDH9A1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     223 (ALDH9A1)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     223 (ALDH9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.1
AA seq 518 aa AA seqDB search
MFLRAGLAALSPLLRSLRPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREDEIATMEC
INNGKSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccgagcaggcctggccgcgctctccccgcttcttcgcagtcttcggccctct
cctgtcgccgccatgagcactggcaccttcgtcgtgtcgcagccgctcaattaccgcggc
ggggcccgcgtggagccggcggacgcctccggtaccgagaaagctttcgagccagcaacc
ggccgagtgatagctactttcacatgttcaggagaaaaggaagtaaatttggctgttcaa
aatgcaaaggctgcttttaaaatatggagtcaaaaatctggcatggagcgttgccgaatc
cttttggaggctgccaggataataagggaacgggaggatgaaattgctactatggagtgc
atcaacaatggcaagtccatctttgaggcccgcttggacattgacatttcctggcagtgc
ctggagtattatgcgggcttggctgcatccatggctggtgaacacatccagctcccaggt
ggatcgtttggttataccagaagagaaccacttggggtatgtgtgggaataggagcatgg
aactacccctttcagattgcctcttggaagtcggctccagcattagcctgtggtaatgcc
atggtctttaaaccttctccctttacacctgtttctgcattgctactggctgaaatctac
agtgaggctggtgtacctcctgggctcttcaatgtggtgcagggaggggctgccacaggc
cagtttctgtgtcagcatcccgatgtggccaaagtctccttcactggaagtgtgcccact
ggcatgaagatcatggagatgtcagctaaaggaatcaaacctgttaccttggaacttgga
ggcaaatctccactcatcatcttctcagactgtgatatgaacaatgctgtaaagggggcg
ctgatggccaacttcctcacacaaggccaggtttgctgtaatggcacaagagtatttgtg
cagaaagaaattcttgataaatttacagaggaagtggtgaaacagacccaaaggattaaa
attggagatccccttctggaagatacaaggatgggtccactcatcaaccgaccacacctg
gagcgagtccttgggtttgtcaaagtggcaaaggagcagggtgctaaagtgttatgtggt
ggagatatatatgtacctgaagatcccaaattaaaggatggatattacatgagaccttgt
gtattaactaattgcagagacgacatgacctgtgtgaaggaagagatctttgggcctgtt
atgtccattttatcatttgacactgaagctgaggttctagaaagagccaatgataccact
tttggactagcagctggcgtctttaccagggacatccaacgggctcatagagtggtagct
gagcttcaggctgggacgtgcttcattaacaactataacgtcagcccagtggagttgccc
tttggtggatataagaagtcaggatttggcagagagaacggccgtgtgacaatcgaatat
tattcacagctgaagactgtgtgtgtggagatgggtgatgtggaatctgctttttga

DBGET integrated database retrieval system