KEGG   Homo sapiens (human): 223Help
Entry
223               CDS       T01001                                 

Gene name
ALDH9A1, ALDH4, ALDH7, ALDH9, E3, TMABADH
Definition
aldehyde dehydrogenase 9 family, member A1 (EC:1.2.1.3 1.2.1.19 1.2.1.47)
Orthology
K00149  
aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:hsa00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.1
AA seq 518 aa AA seqDB search
MFLRAGLAALSPLLRSLRPSPVAAMSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPAT
GRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREDEIATMEC
INNGKSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKPVTLELGGKSPLIIFSDCDMNNAVKGA
LMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPV
MSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccgagcaggcctggccgcgctctccccgcttcttcgcagtcttcggccctct
cctgtcgccgccatgagcactggcaccttcgtcgtgtcgcagccgctcaattaccgcggc
ggggcccgcgtggagccggcggacgcctccggtaccgagaaagctttcgagccagcaacc
ggccgagtgatagctactttcacatgttcaggagaaaaggaagtaaatttggctgttcaa
aatgcaaaggctgcttttaaaatatggagtcaaaaatctggcatggagcgttgccgaatc
cttttggaggctgccaggataataagggaacgggaggatgaaattgctactatggagtgc
atcaacaatggcaagtccatctttgaggcccgcttggacattgacatttcctggcagtgc
ctggagtattatgcgggcttggctgcatccatggctggtgaacacatccagctcccaggt
ggatcgtttggttataccagaagagaaccacttggggtatgtgtgggaataggagcatgg
aactacccctttcagattgcctcttggaagtcggctccagcattagcctgtggtaatgcc
atggtctttaaaccttctccctttacacctgtttctgcattgctactggctgaaatctac
agtgaggctggtgtacctcctgggctcttcaatgtggtgcagggaggggctgccacaggc
cagtttctgtgtcagcatcccgatgtggccaaagtctccttcactggaagtgtgcccact
ggcatgaagatcatggagatgtcagctaaaggaatcaaacctgttaccttggaacttgga
ggcaaatctccactcatcatcttctcagactgtgatatgaacaatgctgtaaagggggcg
ctgatggccaacttcctcacacaaggccaggtttgctgtaatggcacaagagtatttgtg
cagaaagaaattcttgataaatttacagaggaagtggtgaaacagacccaaaggattaaa
attggagatccccttctggaagatacaaggatgggtccactcatcaaccgaccacacctg
gagcgagtccttgggtttgtcaaagtggcaaaggagcagggtgctaaagtgttatgtggt
ggagatatatatgtacctgaagatcccaaattaaaggatggatattacatgagaccttgt
gtattaactaattgcagagacgacatgacctgtgtgaaggaagagatctttgggcctgtt
atgtccattttatcatttgacactgaagctgaggttctagaaagagccaatgataccact
tttggactagcagctggcgtctttaccagggacatccaacgggctcatagagtggtagct
gagcttcaggctgggacgtgcttcattaacaactataacgtcagcccagtggagttgccc
tttggtggatataagaagtcaggatttggcagagagaacggccgtgtgacaatcgaatat
tattcacagctgaagactgtgtgtgtggagatgggtgatgtggaatctgctttttga

DBGET integrated database retrieval system