KEGG   Homo sapiens (human): 2247Help
Entry
2247              CDS       T01001                                 

Gene name
FGF2, BFGF, FGF-2, FGFB, HBGF-2
Definition
fibroblast growth factor 2 (basic)
Orthology
K18497  
fibroblast growth factor 2
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Melanoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2247 (FGF2)
   04015 Rap1 signaling pathway
    2247 (FGF2)
   04010 MAPK signaling pathway
    2247 (FGF2)
   04151 PI3K-Akt signaling pathway
    2247 (FGF2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2247 (FGF2)
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    2247 (FGF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2247 (FGF2)
   05205 Proteoglycans in cancer
    2247 (FGF2)
   05218 Melanoma
    2247 (FGF2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
  2247 (FGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q26
AA seq 288 aa AA seqDB search
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ctggtgggtgtggggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccag
attagcggacgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcg
gctctccccaggcggcgtccgcggagacacccatccgtgaaccccaggtcccgggccgcc
ggctcgccgcgcaccaggggccggcggacagaagagcggccgagcggctcgaggctgggg
gaccgcgggcgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgt
gccccggagcgggtcggaggccggggccggggccgggggacggcggctccccgcgcggct
ccagcggctcggggatcccggccgggccccgcagggaccatggcagccgggagcatcacc
acgctgcccgccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaag
gaccccaagcggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggc
cgagttgacggggtccgggagaagagcgaccctcacatcaagctacaacttcaagcagaa
gagagaggagttgtgtctatcaaaggagtgtgtgctaaccgttacctggctatgaaggaa
gatggaagattactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattg
gaatctaataactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactg
aaacgaactgggcagtataaacttggatccaaaacaggacctgggcagaaagctatactt
tttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system