KEGG   Homo sapiens (human): 22798Help
Entry
22798             CDS       T01001                                 

Gene name
LAMB4
Definition
laminin, beta 4
Orthology
K06245  
laminin, beta 4
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    22798 (LAMB4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    22798 (LAMB4)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    22798 (LAMB4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    22798 (LAMB4)
   05222 Small cell lung cancer
    22798 (LAMB4)
  Infectious diseases
   05146 Amoebiasis
    22798 (LAMB4)
   05145 Toxoplasmosis
    22798 (LAMB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q31
AA seq 1761 aa AA seqDB search
MQFQLTLFLHLGWLSYSKAQDDCNRGACHPTTGDLLVGRNTQLMASSTCGLSRAQKYCIL
SYLEGEQKCFICDSRFPYDPYDQPNSHTIENVIVSFEPDREKKWWQSENGLDHVSIRLDL
EALFRFSHLILTFKTFRPAAMLVERSTDYGHNWKVFKYFAKDCATSFPNITSGQAQGVGD
IVCDSKYSDIEPSTGGEVVLKVLDPSFEIENPYSPYIQDLVTLTNLRINFTKLHTLGDAL
LGRRQNDSLDKYYYALYEMIVRGSCFCNGHASECRPMQKMRGDVFSPPGMVHGQCVCQHN
TDGPNCERCKDFFQDAPWRPAADLQDNACRSCSCNSHSSRCHFDMTTYLASGGLSGGVCE
DCQHNTEGQHCDRCRPLFYRDPLKTISDPYACIPCECDPDGTISGGICVSHSDPALGSVA
GQCLCKENVEGAKCDQCKPNHYGLSATDPLGCQPCDCNPLGSLPFLTCDVDTGQCLCLSY
VTGAHCEECTVGYWGLGNHLHGCSPCDCDIGGAYSNVCSPKNGQCECRPHVTGRSCSEPA
PGYFFAPLNFYLYEAEEATTLQGLAPLGSETFGQSPAVHVVLGEPVPGNPVTWTGPGFAR
VLPGAGLRFAVNNIPFPVDFTIAIHYETQSAADWTVQIVVNPPGGSEHCIPKTLQSKPQS
FALPAATRIMLLPTPICLEPDVQYSIDVYFSQPLQGESHAHSHVLVDSLGLIPQINSLEN
FCSKQDLDEYQLHNCVEIASAMGPQVLPGACERLIISMSAKLHDGAVACKCHPQGSVGSS
CSRLGGQCQCKPLVVGRCCDRCSTGSYDLGHHGCHPCHCHPQGSKDTVCDQVTGQCPCHG
EVSGRRCDRCLAGYFGFPSCHPCPCNRFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPSSGQPCRPCLCPDDPSSNQYFAHSCYQNLWSSDVICNCLQGYTGTQCGECSTGFYGNP
RISGAPCQPCACNNNIDVTDPESCSRVTGECLRCLHNTQGANCQLCKPGHYGSALNQTCR
RCSCHASGVSPMECPPGGGACLCDPVTGACPCLPNVTGLACDRCADGYWNLVPGRGCQSC
DCDPRTSQSSHCDQLTGQCPCKLGYGGKRCSECQENYYGDPPGRCIPCDCNRAGTQKPIC
DPDTGMCRCREGVSGQRCDRCARGHSQEFPTCLQCHLCFDQWDHTISSLSKAVQGLMRLA
ANMEDKRETLPVCEADFKDLRGNVSEIERILKHPVFPSGKFLKVKDYHDSVRRQIMQLNE
QLKAVYEFQDLKDTIERAKNEADLLLEDLQEEIDLQSSVLNASIADSSENIKKYYHISSS
AEKKINETSSTINTSANTRNDLLTILDTLTSKGNLSLERLKQIKIPDIQILNEKVCGDPG
NVPCVPLPCGGALCTGRKGHRKCRGPGCHGSLTLSTNALQKAQEAKSIIRNLDKQVRGLK
NQIESISEQAEVSKNNALQLREKLGNIRNQSDSEEENINLFIKKVKNFLLEENVPPEDIE
KVANGVLDIHLPIPSQNLTDELVKIQKHMQLCEDYRTDENRLNEEADGAQKLLVKAKAAE
KAANILLNLDKTLNQLQQAQITQGRANSTITQLTANITKIKKNVLQAENQTREMKSELEL
AKQRSGLEDGLSLLQTKLQRHQDHAVNAKVQAESAQHQAGSLEKEFVELKKQYAILQRKT
STTGLTKETLGKVKQLKDAAEKLAGDTEAKIRRITDLERKIQDLNLSRQAKADQLRILED
QVVAIKNEIVEQEKKYARCYS
NT seq 5286 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttcaactgaccctttttttgcaccttgggtggctcagttactcaaaagctcaa
gatgactgcaacaggggtgcctgtcatcccaccactggtgatctcctggtgggcaggaac
acgcagcttatggcttcttctacctgtgggctgagcagagcccagaaatactgcatcctc
agttacctggagggggaacaaaaatgcttcatctgtgactctagatttccatatgatccg
tatgaccaacccaacagccacaccattgagaatgtcattgtaagttttgaaccagacaga
gaaaagaaatggtggcaatctgaaaatggtcttgatcatgtcagcatcagactggactta
gaggcattatttcggttcagccaccttatcctgacctttaagacttttcggcctgctgca
atgttagttgaacgttccacagactatggacacaactggaaagtgttcaaatattttgca
aaagactgtgccacttcctttcctaacatcacatctggccaggcccagggagtgggagac
attgtttgtgactccaaatactcggatattgaaccctcaacaggtggagaggttgtttta
aaagttttggatcccagttttgaaattgaaaacccttatagcccctacatccaagacctt
gtgacattgacaaacctgaggataaactttaccaagctccacacccttggggatgctttg
cttggaaggaggcaaaatgattcccttgataaatactactatgctctgtacgagatgatt
gttcggggaagctgcttttgcaatggccatgctagcgaatgtcgccctatgcagaagatg
cggggagatgttttcagccctcctggaatggttcacggtcagtgtgtgtgtcagcacaat
acagatggtccgaactgtgagagatgcaaggacttcttccaggatgctccttggaggcca
gctgcagacctccaggacaacgcttgcagatcgtgcagctgtaatagccactccagccgc
tgtcactttgacatgactacgtacctggcaagcggtggcctcagcgggggcgtgtgtgaa
gactgccagcacaacactgaggggcagcactgcgaccgctgcagacccctcttctacagg
gacccgctcaagaccatctcagatccctacgcgtgcattccttgtgaatgtgaccccgat
gggaccatatctggtggcatttgtgtgagccactctgatcctgccttagggtctgtggcc
ggccagtgcctttgtaaagagaacgtggaaggagccaaatgcgaccagtgcaaacccaac
cactacggactaagcgccaccgaccccctgggctgccagccctgcgactgtaaccccctt
gggagtctgccattcttgacctgtgatgtggatacaggccaatgcttgtgcctgtcatat
gtcaccggagcacactgcgaagaatgcactgttggatactggggcctgggaaatcatctc
catgggtgttctccctgtgactgtgatattggaggtgcttattctaacgtgtgctcaccc
aagaatgggcagtgtgaatgccgcccacatgtcactggccgtagctgctctgaaccagcc
cctggctacttctttgctcctttgaatttctatctctacgaggcagaggaagccacaaca
ctccaaggactggcgcctttgggctcggagacgtttggccagagtcctgctgttcacgtt
gttttaggagagccagttcctgggaaccctgttacatggactggacctggatttgccagg
gttctccctggggctggcttgagatttgctgtcaacaacattccctttcctgtggacttc
accattgccattcactatgaaacccagtctgcagctgactggactgtccagattgtggtg
aacccccctggagggagtgagcactgcatacccaagactctacagtcaaagcctcagtct
tttgccttaccagcggctacgagaatcatgctgcttcccacacccatctgtttagaacca
gatgtacaatattccatagatgtctatttttctcagcctttgcaaggagagtcccacgct
cattcacatgtcctggtggactctcttggccttattccccaaatcaattcattggagaat
ttctgcagcaagcaggacttagatgagtatcagcttcacaactgtgttgaaattgcctca
gcaatgggacctcaagtgctcccgggtgcctgtgaaaggctgatcatcagcatgtctgcc
aagctgcatgatggggctgtggcctgcaagtgtcacccccagggctcagtcggatccagc
tgcagccgacttggaggccagtgccagtgtaaacctcttgtggtcgggcgctgctgtgac
aggtgctcaactggaagctatgatttggggcatcacggctgtcacccatgtcactgccat
cctcaaggatcaaaggacactgtatgtgaccaagtaacaggacagtgcccctgccatgga
gaggtgtctggccgccgctgtgatcgctgcctggcaggctactttggatttcccagctgc
cacccttgcccttgtaataggtttgctgaactttgtgatcctgagacagggtcatgcttc
aattgtggaggctttacaactggcagaaactgtgaaaggtgtattgatggttactatgga
aatccttcttcaggacagccctgtcgtccttgcctgtgtccagatgatccctcaagcaat
cagtattttgcccattcctgttatcagaatctgtggagctcagatgtaatctgcaattgt
cttcaaggttatacgggtactcagtgtggagaatgctctactggtttctatggaaatcca
agaatttcaggagcaccttgccaaccatgtgcctgcaacaacaacatagatgtaaccgat
ccagagtcctgcagccgggtaacaggggagtgccttcgatgtttgcacaacactcagggc
gcaaactgccagctctgcaaaccaggtcactatggatcagccctcaatcagacctgcaga
agatgctcctgccatgcttccggcgtgagtcccatggagtgtccccctggtgggggagct
tgcctctgtgaccctgtcactggtgcatgtccttgtctgccgaatgtcacaggcctggcc
tgtgaccgttgtgctgatggatactggaatctggtccctggcagaggatgtcagtcatgt
gactgtgaccctaggacctctcaaagtagccactgtgaccagcttacaggccagtgtccg
tgtaaattaggttacggcgggaaacgttgcagtgagtgccaggaaaattattatggtgat
ccacctgggcgatgcattccatgtgattgtaacagggcaggtacccagaagcccatctgt
gatccagacacaggcatgtgccgctgccgggagggtgtcagcggccagagatgtgatcgc
tgtgcccggggacacagccaggaattccctacttgtcttcaatgtcacttgtgctttgat
cagtgggaccacaccatttcttccctctccaaagcggtgcaagggttaatgagactggct
gctaacatggaagataaaagagagaccctgcctgtctgtgaggcagacttcaaagacctc
agagggaacgtgtctgaaatagaaaggattttgaaacatcctgttttcccatctgggaaa
ttcttaaaagtcaaggattatcatgactctgttagaagacaaatcatgcagctaaatgaa
caactgaaagcagtgtatgaatttcaagatctgaaagatacaatagaaagagcaaagaat
gaagcagacctcttacttgaagaccttcaggaagaaattgatttgcaatccagtgtcctt
aatgcaagcattgcggactcctcagaaaacatcaagaaatattatcacatatcatcatct
gctgaaaagaaaattaatgaaactagttccaccattaatacctctgcaaatacaaggaat
gacttacttaccatcttagatacactaacctcaaaaggaaacttgtcattggaaagatta
aagcagattaagataccagatatccaaatattgaatgaaaaggtgtgcggagatccagga
aatgtgccatgtgtgcccttgccctgtggcggtgctctctgcacgggccggaaggggcac
aggaagtgtaggggtcccggctgtcacggctccctgaccctctcaacgaatgccctccaa
aaagcccaggaagcaaaatccattattcgtaatttggacaaacaggttcgtgggttgaaa
aatcagatcgaaagtataagtgaacaggcagaagtctccaaaaacaatgccttacagctg
agggaaaaactgggaaatataagaaaccaaagtgactctgaagaagaaaacatcaatctt
ttcatcaaaaaagtgaaaaactttttgttagaggaaaacgtgcctccagaagacatcgag
aaggttgcgaatggtgtgcttgacattcacctaccaattccatcccaaaatctaaccgat
gaacttgtcaaaatacagaaacatatgcaactctgtgaggattacaggacagatgaaaac
aggttaaatgaagaagcagatggagcccaaaagcttttggtgaaggccaaagcagctgag
aaagcagcaaatattctattaaatcttgacaaaacattgaaccagttacaacaagctcaa
atcactcaaggacgggcaaactctaccattacacagctgactgccaatataacaaaaata
aaaaagaatgtgctgcaggctgaaaatcaaaccagggaaatgaagagtgagctggagtta
gcaaagcagcgatcagggctggaggatggactttccctgctgcagaccaagttgcaaagg
catcaagaccacgctgtcaatgcgaaagttcaggctgaatctgcccaacaccaggctggg
agtcttgagaaggaatttgttgagctgaaaaaacaatatgctattctccaacgtaagaca
agcactacaggactaacaaaggagacattaggaaaagttaaacagctaaaagatgcggca
gaaaaattggctggagatacagaggccaagataagaagaataacagatttagaaaggaaa
atccaagatttgaatctaagtagacaagcaaaagctgatcaactgagaatattggaagat
caagttgttgccattaaaaatgaaattgttgaacaagaaaaaaaatatgctaggtgctat
agctag

DBGET integrated database retrieval system