KEGG   Homo sapiens (human): 22802Help
Entry
22802             CDS       T01001                                 

Gene name
CLCA4, CaCC, CaCC2
Definition
chloride channel accessory 4
Orthology
K05030  
calcium-activated chloride channel regulator 4
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Pancreatic secretion
Drug target
Niflumic acid: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    22802 (CLCA4)
  Sensory system
   04740 Olfactory transduction
    22802 (CLCA4)
Ion channels [BR:hsa04040]
 Chloride channels
  Calcium activated chloride channel
   22802 (CLCA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31-p22
AA seq 919 aa AA seqDB search
MGLFRGFVFLLVLCLLHQSNTSFIKLNNNGFEDIVIVIDPSVPEDEKIIEQIEDMVTTAS
TYLFEATEKRFFFKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQ
FTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSK
KIEATRCSAGISGRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQTEKASIMFM
QSIDSVVEFCNEKTHNQEAPSLQNIKCNFRSTWEVISNSEDFKNTIPMVTPPPPPVFSLL
KISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTATIVNKLI
QIKSSDERNTLMAGLPTYPLGGTSICSGIKYAFQVIGELHSQLDGSEVLLLTDGEDNTAS
SCIDEVKQSGAIVHFIALGRAADEAVIEMSKITGGSHFYVSDEAQNNGLIDAFGALTSGN
TDLSQKSLQLESKGLTLNSNAWMNDTVIIDSTVGKDTFFLITWNSLPPSISLWDPSGTIM
ENFTVDATSKMAYLSIPGTAKVGTWAYNLQAKANPETLTITVTSRAANSSVPPITVNAKM
NKDVNSFPSPMIVYAEILQGYVPVLGANVTAFIESQNGHTEVLELLDNGAGADSFKNDGV
YSRYFTAYTENGRYSLKVRAHGGANTARLKLRPPLNRAAYIPGWVVNGEIEANPPRPEID
EDTQTTLEDFSRTASGGAFVVSQVPSLPLPDQYPPSQITDLDATVHEDKIILTWTAPGDN
FDVGKVQRYIIRISASILDLRDSFDDALQVNTTDLSPKEANSKESFAFKPENISEENATH
IFIAIKSIDKSNLTSKVSNIAQVTLFIPQANPDDIDPTPTPTPTPTPDKSHNSGVNISTL
VLSVIGSVVIVNFILSTTI
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggggttattcagaggttttgttttcctcttagttctgtgcctgctgcaccagtcaaat
acttccttcattaagctgaataataatggctttgaagatattgtcattgttatagatcct
agtgtgccagaagatgaaaaaataattgaacaaatagaggatatggtgactacagcttct
acgtacctgtttgaagccacagaaaaaagattttttttcaaaaatgtatctatattaatt
cctgagaattggaaggaaaatcctcagtacaaaaggccaaaacatgaaaaccataaacat
gctgatgttatagttgcaccacctacactcccaggtagagatgaaccatacaccaagcag
ttcacagaatgtggagagaaaggcgaatacattcacttcacccctgaccttctacttgga
aaaaaacaaaatgaatatggaccaccaggcaaactgtttgtccatgagtgggctcacctc
cggtggggagtgtttgatgagtacaatgaagatcagcctttctaccgtgctaagtcaaaa
aaaatcgaagcaacaaggtgttccgcaggtatctctggtagaaatagagtttataagtgt
caaggaggcagctgtcttagtagagcatgcagaattgattctacaacaaaactgtatgga
aaagattgtcaattctttcctgataaagtacaaacagaaaaagcatccataatgtttatg
caaagtattgattctgttgttgaattttgtaacgaaaaaacccataatcaagaagctcca
agcctacaaaacataaagtgcaattttagaagtacatgggaggtgattagcaattctgag
gattttaaaaacaccatacccatggtgacaccacctcctccacctgtcttctcattgctg
aagatcagtcaaagaattgtgtgcttagttcttgataagtctggaagcatggggggtaag
gaccgcctaaatcgaatgaatcaagcagcaaaacatttcctgctgcagactgttgaaaat
ggatcctgggtggggatggttcactttgatagtactgccactattgtaaataagctaatc
caaataaaaagcagtgatgaaagaaacacactcatggcaggattacctacatatcctctg
ggaggaacttccatctgctctggaattaaatatgcatttcaggtgattggagagctacat
tcccaactcgatggatccgaagtactgctgctgactgatggggaggataacactgcaagt
tcttgtattgatgaagtgaaacaaagtggggccattgttcattttattgctttgggaaga
gctgctgatgaagcagtaatagagatgagcaagataacaggaggaagtcatttttatgtt
tcagatgaagctcagaacaatggcctcattgatgcttttggggctcttacatcaggaaat
actgatctctcccagaagtcccttcagctcgaaagtaagggattaacactgaatagtaat
gcctggatgaacgacactgtcataattgatagtacagtgggaaaggacacgttctttctc
atcacatggaacagtctgcctcccagtatttctctctgggatcccagtggaacaataatg
gaaaatttcacagtggatgcaacttccaaaatggcctatctcagtattccaggaactgca
aaggtgggcacttgggcatacaatcttcaagccaaagcgaacccagaaacattaactatt
acagtaacttctcgagcagcaaattcttctgtgcctccaatcacagtgaatgctaaaatg
aataaggacgtaaacagtttccccagcccaatgattgtttacgcagaaattctacaagga
tatgtacctgttcttggagccaatgtgactgctttcattgaatcacagaatggacataca
gaagttttggaacttttggataatggtgcaggcgctgattctttcaagaatgatggagtc
tactccaggtattttacagcatatacagaaaatggcagatatagcttaaaagttcgggct
catggaggagcaaacactgccaggctaaaattacggcctccactgaatagagccgcgtac
ataccaggctgggtagtgaacggggaaattgaagcaaacccgccaagacctgaaattgat
gaggatactcagaccaccttggaggatttcagccgaacagcatccggaggtgcatttgtg
gtatcacaagtcccaagccttcccttgcctgaccaatacccaccaagtcaaatcacagac
cttgatgccacagttcatgaggataagattattcttacatggacagcaccaggagataat
tttgatgttggaaaagttcaacgttatatcataagaataagtgcaagtattcttgatcta
agagacagttttgatgatgctcttcaagtaaatactactgatctgtcaccaaaggaggcc
aactccaaggaaagctttgcatttaaaccagaaaatatctcagaagaaaatgcaacccac
atatttattgccattaaaagtatagataaaagcaatttgacatcaaaagtatccaacatt
gcacaagtaactttgtttatccctcaagcaaatcctgatgacattgatcctacacctact
cctactcctactcctactcctgataaaagtcataattctggagttaatatttctacgctg
gtattgtctgtgattgggtctgttgtaattgttaactttattttaagtaccaccatttga

DBGET integrated database retrieval system