KEGG   Homo sapiens (human): 22827Help
Entry
22827             CDS       T01001                                 

Gene name
PUF60, FIR, RoBPI, SIAHBP1, VRJS
Definition
(RefSeq) poly(U) binding splicing factor 60
  KO
K12838  
poly(U)-binding-splicing factor PUF60
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Disease
H01800  
Verheij syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    22827 (PUF60)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    22827 (PUF60)
 Complex B
    22827 (PUF60)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9UHX1(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
8q24.3
AA seq 559 aa AA seqDB search
MATATIALQVNGQQGGGSEPAAAAAVVAAGDKWKPPQGTDSIKMENGQSTAAKLGLPPLT
PEQQEALQKAKKYAMEQSIKSVLVKQTIAHQQQQLTNLQMAAVTMGFGDPLSPLQSMAAQ
RQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVP
EAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDD
DIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFDLGGQYLRVG
KAVTPPMPLLTPATPGGLPPAAAVAAAAATAKITAQEAVAGAAVLGTLGTPGLVSPALTL
AQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTLGLLEPKKEKE
EEELFPESERPEMLSEQEHMSISGSSARHMVMQKLLRKQESTVMVLRNMVDPKDIDDDLE
GEVTEECGKFGAVNRVIIYQEKQGEEEDAEIIVKIFVEFSIASETHKAIQALNGRWFAGR
KVVAEVYDQERFDNSDLSA
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggcgaccatagctctccaggtcaatggccagcaaggaggggggtccgagccg
gcggcggcggcggcagtggtggcagcgggagacaaatggaaacctccacagggcacagac
tccatcaagatggagaacgggcagagcacagccgccaagctggggctgcctcccctgacg
cccgagcagcaggaggcccttcagaaggccaagaagtacgccatggagcagagcatcaag
agtgtgctggtgaagcagaccatcgcgcaccagcagcagcagctcaccaacctgcagatg
gcagcagtgacaatgggctttggagatcctctctcacctttgcaatcgatggcggctcag
cggcagcgggcgctggccatcatgtgccgcgtctacgtgggctctatctactatgagctg
ggggaggacaccatccgccaggcctttgccccctttggccccatcaagagcatcgacatg
tcctgggactccgtcaccatgaagcacaagggctttgccttcgtggagtatgaggtcccc
gaagctgcacagctggccttggagcagatgaactcggtgatgctggggggcaggaacatc
aaggtgggcagacccagcaacatagggcaggcccagcccatcatagaccagttggctgag
gaggcacgggccttcaaccgcatctacgtggcctctgtgcaccaggacctctcagacgat
gacatcaagagcgtgtttgaggcctttggcaagatcaagtcctgcacactggcccgggac
cccacaactggcaagcacaagggctacggcttcattgagtacgagaaggcccagtcgtcc
caagatgctgtgtcttccatgaacctctttgacctgggtggccagtacttgcgggtgggc
aaggctgtcacaccgcccatgcccctactcacaccagccacgcctggaggcctcccacct
gccgctgctgtggcagctgctgcagccactgccaagatcacagctcaggaagcagtggcc
ggagcagcggtgctgggtaccctgggcacacctggactggtgtccccagcactgaccctg
gcccagcccctgggcactttgccccaggctgtcatggctgcccaggcacctggagtcatc
acaggtgtgaccccagcccgtcctcctatcccggtcaccatcccctcggtgggagtggtg
aaccccatcctggccagccctccaacgctgggtctcctggagcccaagaaggagaaggaa
gaagaggagctgtttcccgagtcagagcggccagagatgctgagcgagcaggagcacatg
agcatctcgggcagtagcgcccgacacatggtgatgcagaagctgctccgcaagcaggag
tctacagtgatggttctgcgcaacatggtggaccccaaggacatcgatgatgacctggaa
ggggaggtgacagaggagtgtggcaagttcggggccgtgaaccgcgtcatcatctaccaa
gagaaacaaggcgaggaggaggatgcagaaatcattgtcaagatctttgtggagttttcc
atagcctctgagactcataaggccatccaggccctcaatggccgctggtttgctggccgc
aaggtggtggctgaagtgtacgaccaggagcgttttgataacagtgacctctctgcgtga

DBGET integrated database retrieval system