KEGG   Homo sapiens (human): 22848Help
Entry
22848             CDS       T01001                                 

Gene name
AAK1
Definition
(RefSeq) AP2 associated kinase 1
  KO
K08853  
AP2-associated kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     22848 (AAK1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Other group
  NAK family [OT]
   22848 (AAK1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    22848 (AAK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p14
AA seq 961 aa AA seqDB search
MKKFFDSRREQGGSGLGSGSSGGGGSTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIV
FLVRTSNGMKCALKRMFVNNEHDLQVCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVW
EVLILMDFCRGGQVVNLMNQRLQTGFTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVE
NILLHDRGHYVLCDFGSATNKFQNPQTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIIT
TKADIWALGCLLYKLCYFTLPFGESQVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDK
RPDIYQVSYFSFKLLKKECPIPNVQNSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTT
ETSIAPRQRPKAGQTQPNPGILPIQPALTPRKRATVQPPPQAAGSSNQPGLLASVPQPKP
QAPPSQPLPQTQAKQPQAPPTPQQTPSTQAQGLPAQAQATPQHQQQLFLKQQQQQQQPPP
AQQQPAGTFYQQQQAQTQQFQAVHPATQQPAIAQFPVVSQGGSQQQLMQNFYQQQQQQQQ
QQQQQQLATALHQQQLMTQQAALQQKPTMAAGQQPQPQPAAAPQPAPAQEPAIQAPVRQQ
PKVQTTPPPAVQGQKVGSLTPPSSPKTQRAGHRRILSDVTHSAVFGVPASKSTQLLQAAA
AEASLNKSKSATTTPSGSPRTSQQNVYNPSEGSTWNPFDDDNFSKLTAEELLNKDFAKLG
EGKHPEKLGGSAESLIPGFQSTQGDAFATTSFSAGTAEKRKGGQTVDSGLPLLSVSDPFI
PLQVPDAPEKLIEGLKSPDTSLLLPDLLPMTDPFGSTSDAVIEKADVAVESLIPGLEPPV
PQRLPSQTESVTSNRTDSLTGEDSLLDCSLLSNPTTDLLEEFAPTAISAPVHKAAEDSNL
ISGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARSLLLVDQLID
L
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttttcgactcccggcgagagcagggcggctctggcctgggctccggctcc
agcggaggagggggcagcacctcgggcctgggcagtggctacatcggaagagtcttcggc
atcgggcgacagcaggtcacagtggacgaggtgttggcggaaggtggatttgctattgta
tttctggtgaggacaagcaatgggatgaaatgtgccttgaaacgcatgtttgtcaacaat
gagcatgatctccaggtgtgcaagagagaaatccagataatgagggatctttcagggcac
aagaatattgtgggttacattgattctagtatcaacaacgtgagtagcggtgatgtatgg
gaagtgctcattctgatggacttttgtagaggtggccaggtggtaaacctgatgaaccag
cgcctgcaaacaggctttacagagaatgaagtgctccagatattttgtgatacctgtgaa
gctgttgcccgcctgcatcagtgcaaaactcctattatccaccgggacctgaaggttgaa
aacatcctcttgcatgaccgaggccactatgtcctgtgtgactttggaagcgccaccaac
aaattccagaatccacaaactgagggagtcaatgcagtagaagatgagattaagaaatac
acaacgctgtcctatcgagcaccagaaatggtcaacctgtacagtggcaaaatcatcact
acgaaggcagacatttgggctcttggatgtttgttgtataaattatgctacttcactttg
ccatttggggaaagtcaggtggcaatttgtgatggaaacttcacaattcctgataattct
cgatattctcaagacatgcactgcctaattaggtatatgttggaaccagaccctgacaaa
aggccggatatttaccaggtgtcctacttctcatttaagctactcaagaaagagtgccca
attccaaatgtacagaactctcccattcctgcaaagcttcctgaaccagtgaaagccagt
gaggcagctgcaaaaaagacccagccaaaggccagactgacagatcccattcccaccaca
gagacttcaattgcaccccgccagaggcctaaagctgggcagactcagccgaacccagga
atccttcccatccagccagcgctgacaccccggaagagggccactgttcagcccccacct
caggctgcaggatccagcaatcagcctggccttttagccagtgttccccaaccaaaaccc
caagccccacccagccagcctctgccgcaaactcaggccaagcagccacaggctcctccc
actccacagcagacgccttctactcaggcccagggtctgcccgctcaggcccaggccaca
ccccagcaccagcagcaactcttcctcaagcagcaacagcagcagcaacagccaccgcca
gcacagcagcagccggcaggcacgttttaccagcagcagcaggcccagactcagcagttt
caggcagtacatccagcaacccagcaaccagcaattgctcagttccctgtggtgtcccaa
ggaggctctcaacagcagctaatgcagaatttctaccagcagcagcagcagcagcaacaa
caacagcaacagcaacagctggccacagccctgcatcaacaacagctgatgactcagcag
gctgccttgcagcaaaagcccactatggcagcaggacagcagccccagccacagccagct
gcagccccacagccagcccctgcccaggagccagcgattcaagccccagtaagacaacag
ccaaaggttcagacaaccccacctcctgccgtccaggggcagaaagttggatctctcact
ccaccctcatcccccaaaacccaacgtgctgggcacaggcgtattctcagtgacgtaacc
cacagtgcagtctttggggtccctgccagcaaatcaacccagctgctccaggcagctgca
gctgaggccagtctcaataagtccaagtctgcaaccaccactccatcaggctctcctcgg
acctctcaacaaaacgtttataatccttcagaagggtctacgtggaatccctttgatgac
gataatttctccaaactcacagctgaagaactgctaaacaaggactttgccaagcttggg
gaaggcaaacatcccgagaagcttggaggctcagctgagagtttgatcccaggctttcaa
tcaacccaaggtgatgcttttgctacgacctcattttctgctggaactgctgaaaaaagg
aagggtgggcagactgtggactctggcctcccgcttctaagcgtgtctgatcctttcatt
cctcttcaagtacctgatgcaccagaaaaactaattgagggactcaaatctcctgacact
tctcttctgctccctgacctcttgcctatgacagatccttttggtagcacttctgatgct
gtaattgaaaaagctgatgttgctgttgagagtctcataccaggactggagcccccagtt
ccccagcgcctcccatctcagacggaatctgtgacctcgaatcgcacagattctctcacc
ggggaagattccctgcttgattgctctctgctctctaaccctactactgaccttctggaa
gagtttgcccccacagcaatctctgctccagtccataaagctgcagaagatagtaatctc
atctcaggttttgatgtccctgagggctcggacaaggtggctgaagatgagtttgaccct
attcctgtattgataaccaaaaacccacaaggtgggcactctagaaacagcagtgggagc
tctgagtccagtcttcccaacctagccaggtctttactgctggtggatcagctcatagac
ctgtag

DBGET integrated database retrieval system