KEGG   Homo sapiens (human): 22919Help
Entry
22919             CDS       T01001                                 

Gene name
MAPRE1, EB1
Definition
(RefSeq) microtubule associated protein RP/EB family member 1
  KO
K10436  
microtubule-associated protein, RP/EB family
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Microtubule-associated proteins
     22919 (MAPRE1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     22919 (MAPRE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q11.1-q11.23
AA seq 268 aa AA seqDB search
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgaacgtatactcaacgtcagtgaccagtgataacctaagtcgacatgacatg
ctggcctggatcaatgagtctctgcagttgaatctgacaaagatcgaacagttgtgctca
ggggctgcgtattgtcagtttatggacatgctgttccctggctccattgccttgaagaaa
gtgaaattccaagctaagctagaacacgagtacatccagaacttcaaaatactacaagca
ggttttaagagaatgggtgttgacaaaataattcctgtggacaaattagtaaaaggaaag
tttcaggacaattttgaattcgttcagtggttcaagaagtttttcgatgcaaactatgat
ggaaaagactatgaccctgtggctgccagacaaggtcaagaaactgcagtggctccttcc
cttgttgctccagctctgaataaaccgaagaaacctctcacttctagcagtgcagctccc
cagaggcccatctcaacacagagaaccgctgcggctcctaaggctggccctggtgtggtg
cgaaagaaccctggtgtgggcaacggagacgacgaggcagctgagttgatgcagcaggtc
aacgtattgaaacttactgttgaagacttggagaaagagagggatttctacttcggaaag
ctacggaacattgaattgatttgccaggagaacgagggggaaaacgaccctgtattgcag
aggattgtagacattctgtatgccacagatgaaggctttgtgatacctgatgaagggggc
ccacaggaggagcaagaagagtattaa

DBGET integrated database retrieval system