KEGG   Homo sapiens (human): 2309Help
Entry
2309              CDS       T01001                                 

Gene name
FOXO3, AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
Definition
forkhead box O3
Orthology
K09408  
forkhead box protein O3
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Neurotrophin signaling pathway
Prolactin signaling pathway
Endometrial cancer
Non-small cell lung cancer
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    2309 (FOXO3)
   04151 PI3K-Akt signaling pathway
    2309 (FOXO3)
   04152 AMPK signaling pathway
    2309 (FOXO3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2309 (FOXO3)
  Endocrine system
   04917 Prolactin signaling pathway
    2309 (FOXO3)
  Nervous system
   04722 Neurotrophin signaling pathway
    2309 (FOXO3)
 Human Diseases
  Cancers
   05213 Endometrial cancer
    2309 (FOXO3)
   05223 Non-small cell lung cancer
    2309 (FOXO3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2309 (FOXO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6q21
AA seq 673 aa AA seqDB search
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
GKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
HSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQT
QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
GAKQASSQSWVPG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcaccggcttccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccagagccgtccgcgatcctgtacgtggcccctgcaaaggccggagctc
caagcgagccctgccaagccctcgggggagacggccgccgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcgggggacgggccggctcggccatggcgatcggc
ggcggcggcgggagcggcacgctgggctccgggctgctccttgaggactcggcccgggtg
ctggcacccggagggcaagaccccgggtctgggccagccaccgcggcgggcgggctgagc
gggggtacacaggcgctgctgcagcctcagcaaccgctgccaccgccgcagccgggggcg
gctgggggctccgggcagccgaggaaatgttcgtcgcggcggaacgcctggggaaacctg
tcctacgcggacctgatcacccgcgccatcgagagctccccggacaaacggctcactctg
tcccagatctacgagtggatggtgcgttgcgtgccctacttcaaggataagggcgacagc
aacagctctgccggctggaagaactccatccggcacaacctgtcactgcatagtcgattc
atgcgggtccagaatgagggaactggcaagagctcttggtggatcatcaaccctgatggg
gggaagagcggaaaagccccccggcggcgggctgtctccatggacaatagcaacaagtat
accaagagccgtggccgcgcagccaagaagaaggcagccctgcagacagcccccgaatca
gctgacgacagtccctcccagctctccaagtggcctggcagccccacgtcacgcagcagt
gatgagctggatgcgtggacggacttccgttcacgcaccaattctaacgccagcacagtc
agtggccgcctgtcgcccatcatggcaagcacagagttggatgaagtccaggacgatgat
gcgcctctctcgcccatgctctacagcagctcagccagcctgtcaccttcagtaagcaag
ccgtgcacggtggaactgccacggctgactgatatggcaggcaccatgaatctgaatgat
gggctgactgaaaacctcatggacgacctgctggataacatcacgctcccgccatcccag
ccatcgcccactgggggactcatgcagcggagctctagcttcccgtataccaccaagggc
tcgggcctgggctccccaaccagctcctttaacagcacggtgttcggaccttcatctctg
aactccctacgccagtctcccatgcagaccatccaagagaacaagccagctaccttctct
tccatgtcacactatggtaaccagacactccaggacctgctcacttcggactcacttagc
cacagcgatgtcatgatgacacagtcggaccccttgatgtctcaggccagcaccgctgtg
tctgcccagaattcccgccggaacgtgatgcttcgcaatgatccgatgatgtcctttgct
gcccagcctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacc
cagggcgctcttggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagt
gagtccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatg
caaaccctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctgccc
gtcatgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttg
gaatgtgacatggagtccattatccgtagtgaactcatggatgctgatgggttggatttt
aactttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcact
ggtgctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system