KEGG   Homo sapiens (human): 2316Help
Entry
2316              CDS       T01001                                 

Gene name
FLNA, ABP-280, ABPX, CSBS, CVD1, FLN, FLN-A, FLN1, FMD, MNS, NHBP, OPD, OPD1, OPD2, XLVD, XMVD
Definition
filamin A, alpha
Orthology
K04437  
filamin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Disease
H00270  
Periventricular nodular heterotopia (PVNH)
H00456  
Fronto-Otopalatodigital Osteodysplasia
H00577  
Syndromic X-linked mental retardation with epilepsy or seizures
H00894  
FG syndrome (FGS)
H01276  
X-linked chronic idiopathic intestinal pseudo-obstruction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2316 (FLNA)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    2316 (FLNA)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2316 (FLNA)
  Infectious diseases
   05132 Salmonella infection
    2316 (FLNA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2316 (FLNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq28
AA seq 2647 aa AA seqDB search
MSSSHSRAGQSAAGAAPGGGVDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVTNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGTGEVEVVI
QDPMGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
SACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPMVPGTYIVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGVVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIRDAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHGGKAPLRVQVQDNEGCPVE
ALVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCAEAGQGDVSIGIKCAPGVVGPAEADIDFDIIRNDNDTFTVKYTP
RGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLSRTGVELGKPTHFTVNAK
AAGKGKLDVQFSGLTKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVNVTYGGDPIPKSP
FSVAVSPSLDLSKIKVSGLGEKVDVGKDQEFTVKSKGAGGQGKVASKIVGPSGAAVPCKV
EPGLGADNSVVRFLPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQGG
SAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTETYVQDRGDGMYKVE
YTPYEEGLHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGPYSISVLYGDEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAAG
KGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTA
LAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDVTSLRPFDLVIPFTIK
KGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYV
DYVNCGHVTAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTC
SVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDL
SLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVIS
QSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDG
TCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHC
DLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQH
VPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSK
AEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSL
QESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVY
LIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAG
ALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPR
LVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASKVVAKGLGLSKAYVGQKSSFTV
DCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGS
PYRVVVP
NT seq 7944 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctcccactctcgggcgggccagagcgcagcaggcgcggctccgggcggcggc
gtcgacacgcgggacgccgagatgccggccaccgagaaggacctggcggaggacgcgccg
tggaagaagatccagcagaacactttcacgcgctggtgcaacgagcacctgaagtgcgtg
agcaagcgcatcgccaacctgcagacggacctgagcgacgggctgcggcttatcgcgctg
ttggaggtgctcagccagaagaagatgcaccgcaagcacaaccagcggcccactttccgc
caaatgcagcttgagaacgtgtcggtggcgctcgagttcctggaccgcgagagcatcaaa
ctggtgtccatcgacagcaaggccatcgtggacgggaacctgaagctgatcctgggcctc
atctggaccctgatcctgcactactccatctccatgcccatgtgggacgaggaggaggat
gaggaggccaagaagcagacccccaagcagaggctcctgggctggatccagaacaagctg
ccgcagctgcccatcaccaacttcagccgggactggcagagcggccgggccctgggcgcc
ctggtggacagctgtgccccgggcctgtgtcctgactgggactcttgggacgccagcaag
cccgttaccaatgcgcgagaggccatgcagcaggcggatgactggctgggcatcccccag
gtgatcacccccgaggagattgtggaccccaacgtggacgagcactctgtcatgacctac
ctgtcccagttccccaaggccaagctgaagccaggggctcccttgcggcccaaactgaac
ccgaagaaagcccgtgcctacgggccaggcatcgagcccacaggcaacatggtgaagaag
cgggcagagttcactgtggagaccagaagtgctggccagggagaggtgctggtgtacgtg
gaggacccggccggacaccaggaggaggcaaaagtgaccgccaataacgacaagaaccgc
accttctccgtctggtacgtccccgaggtgacggggactcataaggttactgtgctcttt
gctggccagcacatcgccaagagccccttcgaggtgtacgtggataagtcacagggtgac
gccagcaaagtgacagcccaaggtcccggcctggagcccagtggcaacatcgccaacaag
accacctactttgagatctttacggcaggagctggcacgggcgaggtcgaggttgtgatc
caggaccccatgggacagaagggcacggtagagcctcagctggaggcccggggcgacagc
acataccgctgcagctaccagcccaccatggagggcgtccacaccgtgcacgtcacgttt
gccggcgtgcccatccctcgcagcccctacactgtcactgttggccaagcctgtaacccg
agtgcctgccgggcggttggccggggcctccagcccaagggtgtgcgggtgaaggagaca
gctgacttcaaggtgtacacaaagggcgctggcagtggggagctgaaggtcaccgtgaag
ggccccaagggagaggagcgcgtgaagcagaaggacctgggggatggcgtgtatggcttc
gagtattaccccatggtccctggaacctatatcgtcaccatcacgtggggtggtcagaac
atcgggcgcagtcccttcgaagtgaaggtgggcaccgagtgtggcaatcagaaggtacgg
gcctggggccctgggctggagggcggcgtcgttggcaagtcagcagactttgtggtggag
gctatcggggacgacgtgggcacgctgggcttctcggtggaagggccatcgcaggctaag
atcgaatgtgacgacaagggcgacggctcctgtgatgtgcgctactggccgcaggaggct
ggcgagtatgccgttcacgtgctgtgcaacagcgaagacatccgcctcagccccttcatg
gctgacatccgtgacgcgccccaggacttccacccagacagggtgaaggcacgtgggcct
ggattggagaagacaggtgtggccgtcaacaagccagcagagttcacagtggatgccaag
cacggtggcaaggccccacttcgggtccaagtccaggacaatgaaggctgccctgtggag
gcgttggtcaaggacaacggcaatggcacttacagctgctcctacgtgcccaggaagccg
gtgaagcacacagccatggtgtcctggggaggcgtcagcatccccaacagccccttcagg
gtgaatgtgggagctggcagccaccccaacaaggtcaaagtatacggccccggagtagcc
aagacagggctcaaggcccacgagcccacctacttcactgtggactgcgccgaggctggc
cagggggacgtcagcatcggcatcaagtgtgcccctggagtggtaggccccgccgaagct
gacatcgacttcgacatcatccgcaatgacaatgacaccttcacggtcaagtacacgccc
cggggggctggcagctacaccattatggtcctctttgctgaccaggccacgcccaccagc
cccatccgagtcaaggtggagccctctcatgacgccagtaaggtgaaggccgagggccct
ggcctcagtcgcactggtgtcgagcttggcaagcccacccacttcacagtaaatgccaaa
gctgctggcaaaggcaagctggacgtccagttctcaggactcaccaagggggatgcagtg
cgagatgtggacatcatcgaccaccatgacaacacctacacagtcaagtacacgcctgtc
cagcagggtccagtaggcgtcaatgtcacttatggaggggatcccatccctaagagccct
ttctcagtggcagtatctccaagcctggacctcagcaagatcaaggtgtctggcctggga
gagaaggtggacgttggcaaagaccaggagttcacagtcaaatcaaagggtgctggtggt
caaggcaaagtggcatccaagattgtgggcccctcgggtgcagcggtgccctgcaaggtg
gagccaggcctgggggctgacaacagtgtggtgcgcttcctgccccgtgaggaagggccc
tatgaggtggaggtgacctatgacggcgtgcccgtgcctggcagcccctttcctctggaa
gctgtggcccccaccaagcctagcaaggtgaaggcgtttgggccggggctgcagggaggc
agtgcgggctcccccgcccgcttcaccatcgacaccaagggcgccggcacaggtggcctg
ggcctgacggtggagggcccctgtgaggcgcagctcgagtgcttggacaatggggatggc
acatgttccgtgtcctacgtgcccaccgagcccggggactacaacatcaacatcctcttc
gctgacacccacatccctggctccccattcaaggcccacgtggttccctgctttgacgca
tccaaagtcaagtgctcaggccccgggctggagcgggccaccgctggggaggtgggccaa
ttccaagtggactgctcgagcgcgggcagcgcggagctgaccattgagatctgctcggag
gcggggcttccggccgaggtgtacatccaggaccacggtgatggcacgcacaccattacc
tacattcccctctgccccggggcctacaccgtcaccatcaagtacggcggccagcccgtg
cccaacttccccagcaagctgcaggtggaacctgcggtggacacttccggtgtccagtgc
tatgggcctggtattgagggccagggtgtcttccgtgaggccaccactgagttcagtgtg
gacgcccgggctctgacacagaccggagggccgcacgtcaaggcccgtgtggccaacccc
tcaggcaacctgacggagacctacgttcaggaccgtggcgatggcatgtacaaagtggag
tacacgccttacgaggagggactgcactccgtggacgtgacctatgacggcagtcccgtg
cccagcagccccttccaggtgcccgtgaccgagggctgcgacccctcccgggtgcgtgtc
cacgggccaggcatccaaagtggcaccaccaacaagcccaacaagttcactgtggagacc
aggggagctggcacgggcggcctgggcctggctgtagagggcccctccgaggccaagatg
tcctgcatggataacaaggacggcagctgctcggtcgagtacatcccttatgaggctggc
acctacagcctcaacgtcacctatggtggccatcaagtgccaggcagtcctttcaaggtc
cctgtgcatgatgtgacagatgcgtccaaggtcaagtgctctgggcccggcctgagccca
ggcatggttcgtgccaacctccctcagtccttccaggtggacacaagcaaggctggtgtg
gccccattgcaggtcaaagtgcaagggcccaaaggcctggtggagccagtggacgtggta
gacaacgctgatggcacccagaccgtcaattatgtgcccagccgagaagggccctacagc
atctcagtactgtatggagatgaagaggtaccccggagccccttcaaggtcaaggtgctg
cctactcatgatgccagcaaggtgaaggccagtggccccgggctcaacaccactggcgtg
cctgccagcctgcccgtggagttcaccatcgatgcaaaggacgccggggagggcctgctg
gctgtccagatcacggatcccgaaggcaagccgaagaagacacacatccaagacaaccat
gacggcacgtatacagtggcctacgtgccagacgtgacaggtcgctacaccatcctcatc
aagtacggtggtgacgagatccccttctccccgtaccgcgtgcgtgccgtgcccaccggg
gacgccagcaagtgcactgtcacagtgtcaatcggaggtcacgggctaggtgctggcatc
ggccccaccattcagattggggaggagacggtgatcactgtggacactaaggcggcaggc
aaaggcaaagtgacgtgcaccgtgtgcacgcctgatggctcagaggtggatgtggacgtg
gtggagaatgaggacggcactttcgacatcttctacacggccccccagccgggcaaatac
gtcatctgtgtgcgctttggtggcgagcacgtgcccaacagccccttccaagtgacggct
ctggctggggaccagccctcggtgcagccccctctacggtctcagcagctggccccacag
tacacctacgcccagggcggccagcagacttgggccccggagaggcccctggtgggtgtc
aatgggctggatgtgaccagcctgaggccctttgaccttgtcatccccttcaccatcaag
aagggcgagatcacaggggaggttcggatgccctcaggcaaggtggcgcagcccaccatc
actgacaacaaagacggcaccgtgaccgtgcggtatgcacccagcgaggctggcctgcac
gagatggacatccgctatgacaacatgcacatcccaggaagccccttgcagttctatgtg
gattacgtcaactgtggccatgtcactgcctatgggcctggcctcacccatggagtagtg
aacaagcctgccaccttcaccgtcaacaccaaggatgcaggagaggggggcctgtctctg
gccattgagggcccgtccaaagcagaaatcagctgcactgacaaccaggatgggacatgc
agcgtgtcctacctgcctgtgctgccgggggactacagcattctagtcaagtacaatgaa
cagcacgtcccaggcagccccttcactgctcgggtcacaggtgacgactccatgcgtatg
tcccacctaaaggtcggctctgctgccgacatccccatcaacatctcagagacggatctc
agcctgctgacggccactgtggtcccgccctcgggccgggaggagccctgtttgctgaag
cggctgcgtaatggccacgtggggatttcattcgtgcccaaggagacgggggagcacctg
gtgcatgtgaagaaaaatggccagcacgtggccagcagccccatcccggtggtgatcagc
cagtcggaaattggggatgccagtcgtgttcgggtctctggtcagggccttcacgaaggc
cacacctttgagcctgcagagtttatcattgatacccgcgatgcaggctatggtgggctc
agcctgtccattgagggccccagcaaggtggacatcaacacagaggacctggaggacggg
acgtgcagggtcacctactgccccacagagccaggcaactacatcatcaacatcaagttt
gccgaccagcacgtgcctggcagccccttctctgtgaaggtgacaggcgagggccgggtg
aaagagagcatcacccgcaggcgtcgggctccttcagtggccaacgttggtagtcattgt
gacctcagcctgaaaatccctgaaattagcatccaggatatgacagcccaggtgaccagc
ccatcgggcaagacccatgaggccgagatcgtggaaggggagaaccacacctactgcatc
cgctttgttcccgctgagatgggcacacacacagtcagcgtgaagtacaagggccagcac
gtgcctgggagccccttccagttcaccgtggggcccctaggggaagggggagcccacaag
gtccgagctgggggccctggcctggagagagctgaagctggagtgccagccgaattcagt
atctggacccgggaagctggtgctggaggcctggccattgctgtcgagggccccagcaag
gctgagatctcttttgaggaccgcaaggacggctcctgtggtgtggcttatgtggtccag
gagccaggtgactacgaagtctcagtcaagttcaacgaggaacacattcccgacagcccc
ttcgtggtgcctgtggcttctccgtctggcgacgcccgccgcctcactgtttctagcctt
caggagtcagggctaaaggtcaaccagccagcctcttttgcagtcagcctgaacggggcc
aagggggcgatcgatgccaaggtgcacagcccctcaggagccctggaggagtgctatgtc
acagaaattgaccaagataagtatgctgtgcgcttcatccctcgggagaatggcgtttac
ctgattgacgtcaagttcaacggcacccacatccctggaagccccttcaagatccgagtt
ggggagcctgggcatggaggggacccaggcttggtgtctgcttacggagcaggtctggaa
ggcggtgtcacagggaacccagctgagttcgtcgtgaacacgagcaatgcgggagctggt
gccctgtcggtgaccattgacggcccctccaaggtgaagatggattgccaggagtgccct
gagggctaccgcgtcacctatacccccatggcacctggcagctacctcatctccatcaag
tacggcggcccctaccacattgggggcagccccttcaaggccaaagtcacaggcccccgt
ctcgtcagcaaccacagcctccacgagacatcatcagtgtttgtagactctctgaccaag
gccacctgtgccccccagcatggggccccgggtcctgggcctgctgacgccagcaaggtg
gtggccaagggcctggggctgagcaaggcctacgtaggccagaagagcagcttcacagta
gactgcagcaaagcaggcaacaacatgctgctggtgggggttcatggcccaaggaccccc
tgcgaggagatcctggtgaagcacgtgggcagccggctctacagcgtgtcctacctgctc
aaggacaagggggagtacacactggtggtcaaatggggggacgagcacatcccaggcagc
ccctaccgcgttgtggtgccctga

DBGET integrated database retrieval system