KEGG   Homo sapiens (human): 2317Help
Entry
2317              CDS       T01001                                 

Gene name
FLNB, ABP-278, ABP-280, AOI, FH1, FLN-B, FLN1L, LRS1, SCT, TABP, TAP
Definition
filamin B, beta
Orthology
K04437  
filamin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Disease
H00461  
FLNB-related disorders
H00499  
Spondylocarpotarsal synostosis syndrome
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Infectious diseases; Salmonella infection [PATH:hsa05132]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p14.3
AA seq 2633 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRADDTDSQSWRSPLKALSEFFKGDPKGDFNKTGLVEPV
NVVDNGDGTHTVTYTPSQEGPYMVSVKYADEEIPRSPFKVKVLPTYDASKVTASGPGLSS
YGVPASLPVDFAIDARDAGEGLLAVQITDQEGKPKRAIVHDNKDGTYAVTYIPDKTGRYM
IGVTYGGDDIPLSPYRIRATQTGDASKCLATGPGIASTVKTGEEVGFVVDAKTAGKGKVT
CTVLTPDGTEAEADVIENEDGTYDIFYTAAKPGTYVIYVRFGGVDIPNSPFTVMATDGEV
TAVEEAPVNACPPGFRPWVTEEAYVPVSDMNGLGFKPFDLVIPFAVRKGEITGEVHMPSG
KTATPEIVDNKDGTVTVRYAPTEVGLHEMHIKYMGSHIPESPLQFYVNYPNSGSVSAYGP
GLVYGVANKTATFTIVTEDAGEGGLDLAIEGPSKAEISCIDNKDGTCTVTYLPTLPGDYS
ILVKYNDKHIPGSPFTAKITDDSRRCSQVKLGSAADFLLDISETDLSSLTASIKAPSGRD
EPCLLKRLPNNHIGISFIPREVGEHLVSIKKNGNHVANSPVSIMVVQSEIGDARRAKVYG
RGLSEGRTFEMSDFIVDTRDAGYGGISLAVEGPSKVDIQTEDLEDGTCKVSYFPTVPGVY
IVSTKFADEHVPGSPFTVKISGEGRVKESITRTSRAPSVATVGSICDLNLKIPEINSSDM
SAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQEMGVHTVSVKYRGQHVTGSPFQFTVGPLG
EGGAHKVRAGGPGLERGEAGVPAEFSIWTREAGAGGLSIAVEGPSKAEITFDDHKNGSCG
VSYIAQEPGNYEVSIKFNDEHIPESPYLVPVIAPSDDARRLTVMSLQESGLKVNQPASFA
IRLNGAKGKIDAKVHSPSGAVEECHVSELEPDKYAVRFIPHENGVHTIDVKFNGSHVVGS
PFKVRVGEPGQAGNPALVSAYGTGLEGGTTGIQSEFFINTTRAGPGTLSVTIEGPSKVKM
DCQETPEGYKVMYTPMAPGNYLISVKYGGPNHIVGSPFKAKVTGQRLVSPGSANETSSIL
VESVTRSSTETCYSAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGV
HGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
NT seq 7902 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctagctgaggacgcgccttggaagaagatccagcagaac
acgttcacacgctggtgcaacgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagacggcaaagccctgggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccgcagaagcctgtggataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcagttatgacttacctgtcccagttccccaaagcc
aagctcaagccgggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaagttcactgtggac
accatcagcgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgacccctgacagtgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggctacacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgagtgttgacaaggcccagggagatgccagtaaagtcactgcaaaa
ggtccagggttggaagctgtagggaacatcgccaataagcccacctactttgacatctat
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
accgtggagttgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcctggccctcacgtggtcaagatcttctttgctggggacactattcctaagagt
cccttcgttgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctacaacccaaaggcgtccgtatccgggagaccacagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcggtgtaaccatgaagggtcctaagggtctggaggagctg
gtgaagcagaaagactttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcgggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcagcggacttcgtggtagaatccattggctctgaagtgggg
tctctggggtttgccattgaaggcccctctcaggcaaagattgagtacaacgaccagaat
gatggatcgtgtgatgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggacagcccgtacatggccttcatccacccagccacg
ggaggctacaaccctgatctggttcgagcatacgggccaggtttggagaaatctggatgc
attgtcaacaacctggccgagttcactgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacgcattgacatccagatgaagaaccggatg
gacggcacatatgcatgctcatacaccccggtgaaggccatcaagcacaccattgctgtg
gtctggggaggcgtgaacatcccgcacagcccctacagggtcaacatcgggcaaggtagc
catcctcagaaggtcaaagtgtttgggccaggtgtggagagaagtggtctgaaggcaaat
gaacctacacacttcacggtggactgtactgaggctggggaaggtgatgtcagtgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgttcacagtcaaatatgtgcctcctgctgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggctgggaaagccccgctc
aacgtgcagttcaacagccctcttcctggcgatgcagtgaaggatttggatatcatcgat
aattatgactactctcacacggttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacggtggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggtcgtgccatgcctagtgacacctgtgacaggccgggag
aacagcacggccaagttcatccctcgggaggaggggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcgctgccaccagatccc
agcaaggtgaaggcccacggtcccggcctcgaaggtggtctcgtgggcaagcctgccgag
ttcaccatcgataccaaaggagctggtactggaggtctgggcttaacggtggaaggtccg
tgcgaggccaaaatcgagtgctccgacaatggtgatgggacctgctccgtctcttacctt
cccacaaaacccggggagtacttcgtcaacatcctctttgaagaagtccacatacctggg
tctcccttcaaagctgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcacgggaaggtgggtgaagctggcctccttagcgtcgactgctcggaa
gcgggaccgggggccctgggcctggaagctgtctcggactcgggaacaaaagccgaagtc
agtattcagaacaacaaagatggcacctacgcggtgacctacgtgcccctgacggccggc
atgtacacgttgaccatgaagtatggtggcgaactcgtgccacacttccccgcccgggtc
aaggtggagcccgccgtggacaccagcaggatcaaagtctttggaccaggaatagaaggg
aaagatgtgttccgggaagctaccaccgactttacagttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgcggatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgacgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccagccatctagggtgcaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcaccgtggttaccagaggcgcaggaattggtggg
cttggcataactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgcaccgggggattacgatgttaatatcaca
tatggaggagcccacatccccggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccccgggctgggctcaggcgtccgagcccgtgtcctg
cagtccttcacggtggacagcagcaaggctggcctggctccgctggaagtgagggttctg
ggcccacgagctgacgacacggattcccagtcatggcgcagccccttgaaagccctttca
gagttctttaaaggtgacccgaagggtgactttaataagacaggcttggtggagccagtg
aacgtggtggacaatggagatggcacacacacagtaacctacaccccatctcaggaggga
ccttacatggtctcagttaaatatgctgatgaagagattcctcgcagtcccttcaaggtc
aaggtccttcccacatatgatgccagcaaagtgactgccagtggccccggccttagttcc
tatggtgtgcctgccagtctacctgtggactttgcaattgatgcccgagatgccggggaa
ggcctgcttgctgttcaaataacggaccaagaaggaaaacccaaaagagccattgtccat
gacaataaagatggcacgtatgctgtcacctacatccccgacaagactgggcgctatatg
attggagtcacctacgggggtgacgacatcccactttctccttatcgcatccgagccaca
cagacgggtgatgccagcaagtgcctggccacgggtcctggaatcgcctccactgtgaaa
actggcgaagaagtaggctttgtggttgatgccaagactgccgggaagggtaaagtgacc
tgcacggttctgaccccagatggcactgaggccgaggccgatgtcattgagaatgaagat
ggaacctatgacatcttctacacagctgccaagccgggcacatatgtgatctatgtgcgc
ttcggtggtgttgatattcctaacagccccttcactgtcatggccacagatggggaagtc
acagccgtggaggaggcaccggtaaatgcatgtccccctggattcaggccctgggtgacc
gaagaggcctatgtcccagtgagtgacatgaacggcctgggatttaagccttttgacctg
gtcattccgtttgctgtcaggaaaggagaaatcactggagaggtccacatgccttctggg
aagacagccacacctgagattgtggacaacaaggacggcacggtcactgttagatatgcc
cccactgaggtcgggctccatgagatgcacatcaaatacatgggcagccacatccctgag
agcccactccagttctacgtgaactaccccaacagtggaagtgtttctgcatacggtcca
ggcctcgtgtatggagtggccaacaaaactgccaccttcaccatcgtcacagaggatgca
ggagaaggtggtctggacttggctattgagggcccctcaaaagcagaaatcagctgcatt
gacaataaagatgggacatgcacagtgacctacctgccgactctgccaggcgactacagc
attctggtcaagtacaatgacaagcacatccctggcagccccttcacagccaagatcaca
gatgacagcaggcggtgctcccaggtgaagttgggctcagccgctgacttcctgctcgac
atcagtgagactgacctcagcagcctgacggccagcattaaggccccatctggccgagac
gagccctgtctcctgaagaggctgcccaacaaccacattggcatctccttcatcccccgg
gaagtgggcgaacatctggtcagcatcaagaaaaatggcaaccatgtggccaacagcccc
gtgtctatcatggtggtccagtcggagattggtgacgcccgccgagccaaagtctatggc
cgcggcctgtcagaaggccggactttcgagatgtctgacttcatcgtggacacaagggat
gcaggttatggtggcatatccttggcggtggaaggccccagcaaagtggacatccagacg
gaggacctggaagatggcacctgcaaagtctcctacttccctaccgtgcctggggtttat
atcgtctccaccaaattcgctgacgagcacgtgcctgggagcccatttaccgtgaagatc
agtggggagggaagagtcaaagagagcatcacccgcaccagtcgggccccgtccgtggcc
actgtcgggagcatttgtgacctgaacctgaaaatcccagaaatcaacagcagtgatatg
tcggcccacgtcaccagcccctctggccgtgtgactgaggcagagattgtgcccatgggg
aagaactcacactgcgtccggtttgtgccccaggagatgggcgtgcacacggtcagcgtc
aagtaccgtgggcagcacgtcaccggcagccccttccagttcaccgtggggccacttggt
gaaggaggcgcccacaaggtgcgggcaggaggccctggcctggagagaggagaagcggga
gtcccagctgagttcagcatttggacccgggaagcaggcgctggaggcctctccatcgct
gttgagggccccagtaaggccgagattacattcgatgaccataaaaatgggtcgtgcggt
gtatcttatattgcccaagagcctggtaactacgaggtgtccatcaagttcaatgatgag
cacatcccggaaagcccctacctggtgccggtcatcgcaccctccgacgacgcccgccgc
ctcactgttatgagccttcaggaatcgggattaaaagttaaccagccagcatcctttgct
ataaggttgaatggcgcaaaaggcaagattgatgcaaaggtgcacagcccctctggagcc
gtggaggagtgccacgtgtctgagctggagccagataagtatgctgttcgcttcatccct
catgagaatggtgtccacaccatcgatgtcaagttcaatgggagccacgtggttggaagc
cccttcaaagtgcgcgttggggagcctggacaagcggggaaccctgccctggtgtccgcc
tatggcacgggactcgaagggggcaccacaggtatccagtcggaattctttattaacacc
acccgagcaggtccagggacattatccgtcaccatcgaaggcccatccaaggttaaaatg
gattgccaggaaacacctgaagggtacaaagtcatgtacacccccatggctcctggtaac
tacctgatcagcgtcaaatacggtgggcccaaccacatcgtgggcagtcccttcaaggcc
aaggtgacaggccagcgtctagttagccctggctcagccaacgagacctcatccatcctg
gtggagtcagtgaccaggtcgtctacagagacctgctatagcgccattcccaaggcatcc
tcggacgccagcaaggtgacctctaagggggcagggctctcaaaggcctttgtgggccag
aagagttccttcctggtggactgcagcaaagctggctccaacatgctgctgatcggggtc
catgggcccaccaccccctgcgaggaggtctccatgaagcatgtaggcaaccagcaatac
aacgtcacatacgtcgtcaaggagaggggcgattatgtgctggctgtgaagtggggggag
gaacacatccctggcagcccttttcatgtcacagtgccttaa

DBGET integrated database retrieval system