KEGG   Homo sapiens (human): 2317Help
Entry
2317              CDS       T01001                                 

Gene name
FLNB, ABP-278, ABP-280, AOI, FH1, FLN-B, FLN1L, LRS1, SCT, TABP, TAP
Definition
(RefSeq) filamin B
  KO
K04437  
filamin
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Disease
H00461  
FLNB-related disorders
H00499  
Spondylocarpotarsal synostosis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2317 (FLNB)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    2317 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2317 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    2317 (FLNB)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     2317 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    2317 (FLNB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2317 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3p14.3
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVSVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKIFFAGDTIPKSPFVVQVGEACNPNACRASGRGLQPKGVRIRETTDFKVDTK
AAGSGELGVTMKGPKGLEELVKQKDFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYNDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGC
IVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRENSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPESPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGTGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLISVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctagctgaggacgcgccttggaagaagatccagcagaac
acgttcacacgctggtgcaacgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagaccgacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcccgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagacggcaaagccctgggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccgcagaagcctgtggataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcagttatgacttacctgtcccagttccccaaagcc
aagctcaagccgggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaagttcactgtggac
accatcagcgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaggaggcacaagtgacccctgacagtgacaagaacaagacatactctgtggagtatctg
cccaaggtcaccgggctacacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgagtgttgacaaggcccagggagatgccagtaaagtcactgcaaaa
ggtccagggttggaagctgtagggaacatcgccaataagcccacctactttgacatctat
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
accgtggagttgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcctggccctcacgtggtcaagatcttctttgctggggacactattcctaagagt
cccttcgttgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctacaacccaaaggcgtccgtatccgggagaccacagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcggtgtaaccatgaagggtcctaagggtctggaggagctg
gtgaagcagaaagactttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcgggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcagcggacttcgtggtagaatccattggctctgaagtgggg
tctctggggtttgccattgaaggcccctctcaggcaaagattgagtacaacgaccagaat
gatggatcgtgtgatgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggacagcccgtacatggccttcatccacccagccacg
ggaggctacaaccctgatctggttcgagcatacgggccaggtttggagaaatctggatgc
attgtcaacaacctggccgagttcactgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacgcattgacatccagatgaagaaccggatg
gacggcacatatgcatgctcatacaccccggtgaaggccatcaagcacaccattgctgtg
gtctggggaggcgtgaacatcccgcacagcccctacagggtcaacatcgggcaaggtagc
catcctcagaaggtcaaagtgtttgggccaggtgtggagagaagtggtctgaaggcaaat
gaacctacacacttcacggtggactgtactgaggctggggaaggtgatgtcagtgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgttcacagtcaaatatgtgcctcctgctgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggctgggaaagccccgctc
aacgtgcagttcaacagccctcttcctggcgatgcagtgaaggatttggatatcatcgat
aattatgactactctcacacggttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacggtggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggtcgtgccatgcctagtgacacctgtgacaggccgggag
aacagcacggccaagttcatccctcgggaggaggggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcgctgccaccagatccc
agcaaggtgaaggcccacggtcccggcctcgaaggtggtctcgtgggcaagcctgccgag
ttcaccatcgataccaaaggagctggtactggaggtctgggcttaacggtggaaggtccg
tgcgaggccaaaatcgagtgctccgacaatggtgatgggacctgctccgtctcttacctt
cccacaaaacccggggagtacttcgtcaacatcctctttgaagaagtccacatacctggg
tctcccttcaaagctgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcacgggaaggtgggtgaagctggcctccttagcgtcgactgctcggaa
gcgggaccgggggccctgggcctggaagctgtctcggactcgggaacaaaagccgaagtc
agtattcagaacaacaaagatggcacctacgcggtgacctacgtgcccctgacggccggc
atgtacacgttgaccatgaagtatggtggcgaactcgtgccacacttccccgcccgggtc
aaggtggagcccgccgtggacaccagcaggatcaaagtctttggaccaggaatagaaggg
aaagatgtgttccgggaagctaccaccgactttacagttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgcggatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgacgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccagccatctagggtgcaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcaccgtggttaccagaggcgcaggaattggtggg
cttggcataactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgcaccgggggattacgatgttaatatcaca
tatggaggagcccacatccccggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccccgggctgggctcaggcgtccgagcccgtgtcctg
cagtccttcacggtggacagcagcaaggctggcctggctccgctggaagtgagggttctg
ggcccacgaggcttggtggagccagtgaacgtggtggacaatggagatggcacacacaca
gtaacctacaccccatctcaggagggaccttacatggtctcagttaaatatgctgatgaa
gagattcctcgcagtcccttcaaggtcaaggtccttcccacatatgatgccagcaaagtg
actgccagtggccccggccttagttcctatggtgtgcctgccagtctacctgtggacttt
gcaattgatgcccgagatgccggggaaggcctgcttgctgttcaaataacggaccaagaa
ggaaaacccaaaagagccattgtccatgacaataaagatggcacgtatgctgtcacctac
atccccgacaagactgggcgctatatgattggagtcacctacgggggtgacgacatccca
ctttctccttatcgcatccgagccacacagacgggtgatgccagcaagtgcctggccacg
ggtcctggaatcgcctccactgtgaaaactggcgaagaagtaggctttgtggttgatgcc
aagactgccgggaagggtaaagtgacctgcacggttctgaccccagatggcactgaggcc
gaggccgatgtcattgagaatgaagatggaacctatgacatcttctacacagctgccaag
ccgggcacatatgtgatctatgtgcgcttcggtggtgttgatattcctaacagccccttc
actgtcatggccacagatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtgaccgaagaggcctatgtcccagtgagtgacatgaac
ggcctgggatttaagccttttgacctggtcattccgtttgctgtcaggaaaggagaaatc
actggagaggtccacatgccttctgggaagacagccacacctgagattgtggacaacaag
gacggcacggtcactgttagatatgcccccactgaggtcgggctccatgagatgcacatc
aaatacatgggcagccacatccctgagagcccactccagttctacgtgaactaccccaac
agtggaagtgtttctgcatacggtccaggcctcgtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacagaggatgcaggagaaggtggtctggacttggctattgagggc
ccctcaaaagcagaaatcagctgcattgacaataaagatgggacatgcacagtgacctac
ctgccgactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
ggcagccccttcacagccaagatcacagatgacagcaggcggtgctcccaggtgaagttg
ggctcagccgctgacttcctgctcgacatcagtgagactgacctcagcagcctgacggcc
agcattaaggccccatctggccgagacgagccctgtctcctgaagaggctgcccaacaac
cacattggcatctccttcatcccccgggaagtgggcgaacatctggtcagcatcaagaaa
aatggcaaccatgtggccaacagccccgtgtctatcatggtggtccagtcggagattggt
gacgcccgccgagccaaagtctatggccgcggcctgtcagaaggccggactttcgagatg
tctgacttcatcgtggacacaagggatgcaggttatggtggcatatccttggcggtggaa
ggccccagcaaagtggacatccagacggaggacctggaagatggcacctgcaaagtctcc
tacttccctaccgtgcctggggtttatatcgtctccaccaaattcgctgacgagcacgtg
cctgggagcccatttaccgtgaagatcagtggggagggaagagtcaaagagagcatcacc
cgcaccagtcgggccccgtccgtggccactgtcgggagcatttgtgacctgaacctgaaa
atcccagaaatcaacagcagtgatatgtcggcccacgtcaccagcccctctggccgtgtg
actgaggcagagattgtgcccatggggaagaactcacactgcgtccggtttgtgccccag
gagatgggcgtgcacacggtcagcgtcaagtaccgtgggcagcacgtcaccggcagcccc
ttccagttcaccgtggggccacttggtgaaggaggcgcccacaaggtgcgggcaggaggc
cctggcctggagagaggagaagcgggagtcccagctgagttcagcatttggacccgggaa
gcaggcgctggaggcctctccatcgctgttgagggccccagtaaggccgagattacattc
gatgaccataaaaatgggtcgtgcggtgtatcttatattgcccaagagcctggtaactac
gaggtgtccatcaagttcaatgatgagcacatcccggaaagcccctacctggtgccggtc
atcgcaccctccgacgacgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcatcctttgctataaggttgaatggcgcaaaaggcaagattgat
gcaaaggtgcacagcccctctggagccgtggaggagtgccacgtgtctgagctggagcca
gataagtatgctgttcgcttcatccctcatgagaatggtgtccacaccatcgatgtcaag
ttcaatgggagccacgtggttggaagccccttcaaagtgcgcgttggggagcctggacaa
gcggggaaccctgccctggtgtccgcctatggcacgggactcgaagggggcaccacaggt
atccagtcggaattctttattaacaccacccgagcaggtccagggacattatccgtcacc
atcgaaggcccatccaaggttaaaatggattgccaggaaacacctgaagggtacaaagtc
atgtacacccccatggctcctggtaactacctgatcagcgtcaaatacggtgggcccaac
cacatcgtgggcagtcccttcaaggccaaggtgacaggccagcgtctagttagccctggc
tcagccaacgagacctcatccatcctggtggagtcagtgaccaggtcgtctacagagacc
tgctatagcgccattcccaaggcatcctcggacgccagcaaggtgacctctaagggggca
gggctctcaaaggcctttgtgggccagaagagttccttcctggtggactgcagcaaagct
ggctccaacatgctgctgatcggggtccatgggcccaccaccccctgcgaggaggtctcc
atgaagcatgtaggcaaccagcaatacaacgtcacatacgtcgtcaaggagaggggcgat
tatgtgctggctgtgaagtggggggaggaacacatccctggcagcccttttcatgtcaca
gtgccttaa

DBGET integrated database retrieval system