KEGG   Homo sapiens (human): 23189Help
Entry
23189             CDS       T01001                                 

Gene name
KANK1, ANKRD15, CPSQ2, KANK
Definition
KN motif and ankyrin repeat domains 1
Organism
hsa  Homo sapiens (human)
Disease
H01097  
Cerebral palsy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9p24.3
AA seq 1352 aa AA seqDB search
MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKR
LNIQKRRKPSVPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISK
PPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFR
RPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAAPTTSSMGSSIR
HSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQ
LVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQS
TQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSR
SCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETT
HDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGT
SVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVC
ETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEA
AVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVG
EGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNYLVGLKMRTIA
CGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTL
LAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITG
NYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQI
AAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSE
SDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKSARVEDEMQVQECEPEKVEIR
ERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYI
AAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPI
MLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADV
NIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLL
YAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atggctcacaccacaaaggttaacggcagtgcctcaggaaaagcaggtgatattctcagt
ggagaccaggacaaggaacagaaagacccttactttgtggagaccccctatggttatcaa
ctagacttagatttcctcaaatatgtggatgacatacagaagggaaataccatcaaaaga
ctgaacatccagaagaggcggaagccgtccgtgccatgcccagaacccaggaccacatct
ggtcagcaaggtatatggacttccactgaatccctctcatcctccaacagtgatgacaac
aagcagtgccccaacttcctcatagccagaagtcaagttacatcaactccaatctcaaag
ccacctccccctctggagacctcactcccttttcttaccatcccagaaaatcgacagctg
ccacctccctcaccacaactcccaaagcataaccttcatgtcaccaagacactgatggag
acccggagaagactggaacaggagagagccaccatgcagatgacaccgggtgagttcaga
aggcccaggctggccagttttggaggcatgggcaccacaagctccctcccttcttttgtg
ggttctggaaaccacaatcctgccaagcaccagcttcagaatggataccaaggtaatggg
gattatggtagctatgccccagctgctcccaccacttcctccatggggagctccatccgc
cacagccccctgagctcagggatctccaccccagtgaccaacgtgagccccatgcacctg
cagcacatccgcgagcagatggccattgctctgaaacgcctgaaggagctggaggagcag
gtgcgaaccatccctgtgctccaggtaaagatctctgtcttgcaagaagagaaaaggcag
ttggtctcacagctgaaaaaccaaagggctgcatcccagatcaatgtctgtggtgtgagg
aagcggtcctatagtgcggggaacgcctcccagctggaacagctctcccgggcccgaaga
agtggcggggaattatacattgactatgaggaggaagaaatggagaccgtagaacagagc
acgcagaggataaaggagttccggcaacttacagcagacatgcaagccctggagcagaag
atccaggacagcagctgtgaggcctcctcagagctcagggagaatggagagtgccggtct
gtggctgtgggtgccgaggagaacatgaacgacatcgtcgtgtaccacagaggctccagg
tcctgtaaggatgcagctgtagggacacttgttgagatgagaaattgtggggtcagcgtg
acagaggccatgcttggagtgatgactgaagctgacaaagaaattgagctgcaacagcag
accatagaatccttgaaggaaaagatctatcgcctagaagtacagcttagagaaaccacc
catgaccgggagatgactaaactgaaacaagagctgcaggctgctggatcgaggaaaaag
gttgacaaagccacgatggcccagccgcttgttttcagtaaggtggtggaggcagtggtg
cagaccagagaccaaatggtcggcagtcacatggacctggtggacacgtgtgttgggacc
tccgtggaaacaaacagtgtaggcatctcctgccagcctgaatgtaagaataaagtcgta
gggcctgagctgcctatgaattggtggattgttaaggagagggtggaaatgcatgaccga
tgtgctgggaggtctgtggaaatgtgtgacaagagtgtgagtgtggaagtcagcgtctgc
gaaacaggcagcaacacagaggagtctgtgaacgacctcacactcctcaagacaaacttg
aatctcaaagaagtgcggtctatcggttgtggagattgttctgttgacgtgaccgtctgc
tctccaaaggagtgcgcctcccggggcgtgaacactgaggctgttagccaggtggaagct
gccgtcatggcagtgcctcgtactgcagaccaggacactagcacagatttggaacaggtg
caccagttcaccaacaccgagacggccaccctcatagagtcctgcaccaacacttgtcta
agcactttggacaagcagaccagcacccagactgtggagacgcggacagtagctgtagga
gaaggccgtgtcaaggacatcaactcctccaccaagacgcggtccattggtgttggaacg
ttgctttctggccattctgggtttgacaggccatcagctgtgaagaccaaagagtcaggt
gtggggcagataaatattaacgacaactatctggttggtctcaaaatgaggactatagct
tgtgggccaccacagttgactgtggggctgacagccagcagaaggagcgtgggggttggg
gatgaccctgtaggggaatctctggagaacccccagcctcaagctccacttggaatgatg
actggcctggatcactacattgagcgtatccagaagctgctggcagaacagcagacactg
ctggctgagaactacagtgaactggcagaagctttcggggaacctcactcacagatgggc
tccctcaactctcagctcatcagcaccctgtcgtctatcaactctgtcatgaaatctgca
agcactgaagagctgaggaaccctgacttccagaaaaccagtctgggtaaaatcacaggc
aattatttgggatatacctgtaagtgtgggggccttcagtcaggaagtcccttaagctcc
cagacatcccagcctgagcaagaagtggggacctcagaaggaaagccaatcagcagcctg
gatgccttccccactcaggaaggtacgctgtctccagtgaacctgacagacgaccagatc
gccgctggcctctatgcatgtacaaacaatgaaagtacactgaagtccatcatgaagaag
aaagatggtaacaaagattcaaatggcgcaaaaaagaatcttcagtttgttggcattaat
ggagggtatgaaacaacttcaagtgatgattccagctcagatgaaagctcttcttccgag
tcagatgacgagtgtgatgtcattgagtatcctcttgaagaagaggaggaggaggaggat
gaagacactcggggaatggcagaagggcaccatgcagttaatattgaaggtttgaagtct
gccagggtggaagatgaaatgcaggttcaagaatgtgaacctgagaaggtggaaatcaga
gagaggtatgaattaagtgaaaagatgttgtctgcatgcaacttactgaaaaatactata
aatgaccccaaagctttgaccagcaaagatatgaggttctgtctgaacaccctccagcac
gagtggttccgcgtgtccagtcagaagtcagccattccagccatggtgggggactacata
gctgcttttgaggccatttccccagatgtcctccgctatgtcatcaacttggcagacggc
aacggcaacacagccctccattacagcgtgtcccactccaacttcgagattgtgaagctg
ctgttagatgccgatgtgtgtaatgtggatcaccagaacaaggcaggctacacccccatc
atgttggcggccctcgccgctgtggaagcagagaaggacatgcggattgtggaagaactc
ttcggctgtggggatgtgaatgccaaagctagtcaggcgggacagacggccctcatgctg
gcggtcagtcacggacggatagacatggtgaagggccttctggcctgtggggctgatgtc
aacatccaggatgacgagggctccacggccctcatgtgtgccagcgagcacgggcacgtg
gagattgtcaagctgctgctggcccagcccggctgcaacggtcacctagaggacaacgat
ggcagcactgcgctctcaatcgccctggaagcaggacacaaggacatcgctgttcttctg
tatgcccatgtcaactttgcaaaagcccagtctccgggcacccctaggcttggaaggaag
acgtctcctggccccacccaccgaggttcatttgattga

DBGET integrated database retrieval system