KEGG   Homo sapiens (human): 2321Help
Entry
2321              CDS       T01001                                 

Gene name
FLT1, FLT, FLT-1, VEGFR-1, VEGFR1
Definition
(RefSeq) fms related tyrosine kinase 1
  KO
K05096  
FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Transcriptional misregulation in cancer
Rheumatoid arthritis
Drug target
Axitinib: 
Cabozantinib (DG01670): 
Cediranib (DG01360): 
Dovitinib lactate: 
Icrucumab: 
Ilorasertib: 
Lenvatinib (DG01362): 
Linifanib: 
Motesanib (DG01262): 
Nintedanib (DG01374): 
Pazopanib: 
Regorafenib (DG00720): 
Sunitinib (DG00712): 
Tivozanib (DG01375): 
Toceranib (DG01363): 
Vatalanib: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2321 (FLT1)
   04015 Rap1 signaling pathway
    2321 (FLT1)
   04066 HIF-1 signaling pathway
    2321 (FLT1)
   04151 PI3K-Akt signaling pathway
    2321 (FLT1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2321 (FLT1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2321 (FLT1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    2321 (FLT1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2321 (FLT1)
  Immune diseases
   05323 Rheumatoid arthritis
    2321 (FLT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2321 (FLT1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  VEGFR family [OT]
   2321 (FLT1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class V (VEGF receptor family)
   2321 (FLT1)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class V (VEGF receptor family)
   2321 (FLT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P17948(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
13q12.3
AA seq 1338 aa AA seqDB search
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC
CSPPPDYNSVVLYSTPPI
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgcttctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacatcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaatggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttccgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
atgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
cagcaggtgcttgaaaccgtagctggcaagcggtcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagatgggttacctgcgactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgtttaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccggctctctacccactgggcagcagacaaatcctgacttgtaccgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagatggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacgttacttggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctgcaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagagatcaggaagca
ccatacctcctgcgaaacctcagtgatcacacagtggccatcagcagttccaccacttta
gactgtcatgctaatggtgtccccgagcctcagatcacttggtttaaaaacaaccacaaa
atacaacaagagcctggaattattttaggaccaggaagcagcacgctgtttattgaaaga
gtcacagaagaggatgaaggtgtctatcactgcaaagccaccaaccagaagggctctgtg
gaaagttcagcatacctcactgttcaaggaacctcggacaagtctaatctggagctgatc
actctaacatgcacctgtgtggctgcgactctcttctggctcctattaaccctctttatc
cgaaaaatgaaaaggtcttcttctgaaataaagactgactacctatcaattataatggac
ccagatgaagttcctttggatgagcagtgtgagcggctcccttatgatgccagcaagtgg
gagtttgcccgggagagacttaaactgggcaaatcacttggaagaggggcttttggaaaa
gtggttcaagcatcagcatttggcattaagaaatcacctacgtgccggactgtggctgtg
aaaatgctgaaagagggggccacggccagcgagtacaaagctctgatgactgagctaaaa
atcttgacccacattggccaccatctgaacgtggttaacctgctgggagcctgcaccaag
caaggagggcctctgatggtgattgttgaatactgcaaatatggaaatctctccaactac
ctcaagagcaaacgtgacttattttttctcaacaaggatgcagcactacacatggagcct
aagaaagaaaaaatggagccaggcctggaacaaggcaagaaaccaagactagatagcgtc
accagcagcgaaagctttgcgagctccggctttcaggaagataaaagtctgagtgatgtt
gaggaagaggaggattctgacggtttctacaaggagcccatcactatggaagatctgatt
tcttacagttttcaagtggccagaggcatggagttcctgtcttccagaaagtgcattcat
cgggacctggcagcgagaaacattcttttatctgagaacaacgtggtgaagatttgtgat
tttggccttgcccgggatatttataagaaccccgattatgtgagaaaaggagatactcga
cttcctctgaaatggatggctcctgaatctatctttgacaaaatctacagcaccaagagc
gacgtgtggtcttacggagtattgctgtgggaaatcttctccttaggtgggtctccatac
ccaggagtacaaatggatgaggacttttgcagtcgcctgagggaaggcatgaggatgaga
gctcctgagtactctactcctgaaatctatcagatcatgctggactgctggcacagagac
ccaaaagaaaggccaagatttgcagaacttgtggaaaaactaggtgatttgcttcaagca
aatgtacaacaggatggtaaagactacatcccaatcaatgccatactgacaggaaatagt
gggtttacatactcaactcctgccttctctgaggacttcttcaaggaaagtatttcagct
ccgaagtttaattcaggaagctctgatgatgtcagatacgtaaatgctttcaagttcatg
agcctggaaagaatcaaaacctttgaagaacttttaccgaatgccacctccatgtttgat
gactaccagggcgacagcagcactctgttggcctctcccatgctgaagcgcttcacctgg
actgacagcaaacccaaggcctcgctcaagattgacttgagagtaaccagtaaaagtaag
gagtcggggctgtctgatgtcagcaggcccagtttctgccattccagctgtgggcacgtc
agcgaaggcaagcgcaggttcacctacgaccacgctgagctggaaaggaaaatcgcgtgc
tgctccccgcccccagactacaactcggtggtcctgtactccaccccacccatctag

DBGET integrated database retrieval system