KEGG   Homo sapiens (human): 2321Help
Entry
2321              CDS       T01001                                 

Gene name
FLT1, FLT, FLT-1, VEGFR-1, VEGFR1
Definition
fms-related tyrosine kinase 1 (EC:2.7.10.1)
Orthology
K05096  
FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Transcriptional misregulation in cancer
Rheumatoid arthritis
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2321 (FLT1)
   04015 Rap1 signaling pathway
    2321 (FLT1)
   04066 HIF-1 signaling pathway
    2321 (FLT1)
   04151 PI3K-Akt signaling pathway
    2321 (FLT1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2321 (FLT1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2321 (FLT1)
  Cellular commiunity
   04510 Focal adhesion
    2321 (FLT1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    2321 (FLT1)
  Immune diseases
   05323 Rheumatoid arthritis
    2321 (FLT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2321 (FLT1)
Protein kinases [BR:hsa01001]
 Tyrosine protein kinases
  VEGFR family [OT]
   2321 (FLT1)
Enzyme-linked receptors [BR:hsa01020]
 Receptor tyrosine kinases
  RTK class V (VEGF receptor family)
   2321 (FLT1)
Cytokine receptors [BR:hsa04050]
 Receptor tyrosine kinase
  RTK class V (VEGF receptor family)
   2321 (FLT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12
AA seq 687 aa AA seqDB search
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGEHC
NKKAVFSRISKFKSTRNDCTTQSNVKH
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgcttctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacatcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaatggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttccgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
atgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
cagcaggtgcttgaaaccgtagctggcaagcggtcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagatgggttacctgcgactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgtttaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccggctctctacccactgggcagcagacaaatcctgacttgtaccgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagatggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacgttacttggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctgcaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagaggtgagcactgc
aacaaaaaggctgttttctctcggatctccaaatttaaaagcacaaggaatgattgtacc
acacaaagtaatgtaaaacattaa

DBGET integrated database retrieval system