KEGG   Homo sapiens (human): 2321Help
Entry
2321              CDS       T01001                                 

Gene name
FLT1, FLT, FLT-1, VEGFR-1, VEGFR1
Definition
fms-related tyrosine kinase 1 (EC:2.7.10.1)
Orthology
K05096  
FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Transcriptional misregulation in cancer
Rheumatoid arthritis
Drug target
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:hsa04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:hsa04144]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12
AA seq 687 aa AA seqDB search
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGEHC
NKKAVFSRISKFKSTRNDCTTQSNVKH
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctactgggacaccggggtcctgctgtgcgcgctgctcagctgtctgcttctc
acaggatctagttcaggttcaaaattaaaagatcctgaactgagtttaaaaggcacccag
cacatcatgcaagcaggccagacactgcatctccaatgcaggggggaagcagcccataaa
tggtctttgcctgaaatggtgagtaaggaaagcgaaaggctgagcataactaaatctgcc
tgtggaagaaatggcaaacaattctgcagtactttaaccttgaacacagctcaagcaaac
cacactggcttctacagctgcaaatatctagctgtacctacttcaaagaagaaggaaaca
gaatctgcaatctatatatttattagtgatacaggtagacctttcgtagagatgtacagt
gaaatccccgaaattatacacatgactgaaggaagggagctcgtcattccctgccgggtt
acgtcacctaacatcactgttactttaaaaaagtttccacttgacactttgatccctgat
ggaaaacgcataatctgggacagtagaaagggcttcatcatatcaaatgcaacgtacaaa
gaaatagggcttctgacctgtgaagcaacagtcaatgggcatttgtataagacaaactat
ctcacacatcgacaaaccaatacaatcatagatgtccaaataagcacaccacgcccagtc
aaattacttagaggccatactcttgtcctcaattgtactgctaccactcccttgaacacg
agagttcaaatgacctggagttaccctgatgaaaaaaataagagagcttccgtaaggcga
cgaattgaccaaagcaattcccatgccaacatattctacagtgttcttactattgacaaa
atgcagaacaaagacaaaggactttatacttgtcgtgtaaggagtggaccatcattcaaa
tctgttaacacctcagtgcatatatatgataaagcattcatcactgtgaaacatcgaaaa
cagcaggtgcttgaaaccgtagctggcaagcggtcttaccggctctctatgaaagtgaag
gcatttccctcgccggaagttgtatggttaaaagatgggttacctgcgactgagaaatct
gctcgctatttgactcgtggctactcgttaattatcaaggacgtaactgaagaggatgca
gggaattatacaatcttgctgagcataaaacagtcaaatgtgtttaaaaacctcactgcc
actctaattgtcaatgtgaaaccccagatttacgaaaaggccgtgtcatcgtttccagac
ccggctctctacccactgggcagcagacaaatcctgacttgtaccgcatatggtatccct
caacctacaatcaagtggttctggcacccctgtaaccataatcattccgaagcaaggtgt
gacttttgttccaataatgaagagtcctttatcctggatgctgacagcaacatgggaaac
agaattgagagcatcactcagcgcatggcaataatagaaggaaagaataagatggctagc
accttggttgtggctgactctagaatttctggaatctacatttgcatagcttccaataaa
gttgggactgtgggaagaaacataagcttttatatcacagatgtgccaaatgggtttcat
gttaacttggaaaaaatgccgacggaaggagaggacctgaaactgtcttgcacagttaac
aagttcttatacagagacgttacttggattttactgcggacagttaataacagaacaatg
cactacagtattagcaagcaaaaaatggccatcactaaggagcactccatcactcttaat
cttaccatcatgaatgtttccctgcaagattcaggcacctatgcctgcagagccaggaat
gtatacacaggggaagaaatcctccagaagaaagaaattacaatcagaggtgagcactgc
aacaaaaaggctgttttctctcggatctccaaatttaaaagcacaaggaatgattgtacc
acacaaagtaatgtaaaacattaa

DBGET integrated database retrieval system