KEGG   Homo sapiens (human): 2322Help
Entry
2322              CDS       T01001                                 

Gene name
FLT3, CD135, FLK-2, FLK2, STK1
Definition
fms-related tyrosine kinase 3 (EC:2.7.10.1)
Orthology
K05092  
fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Pathways in cancer
Transcriptional misregulation in cancer
Acute myeloid leukemia
Disease
H00003  
Acute myeloid leukemia (AML)
Drug target
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; Acute myeloid leukemia [PATH:hsa05221]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q12
AA seq 993 aa AA seqDB search
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgttggcgcgcgacggcggccagctgccgctgctcgttgttttttctgcaatg
atatttgggactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaatcat
aagaacaatgattcatcagtggggaagtcatcatcatatcccatggtatcagaatccccg
gaagacctcgggtgtgcgttgagaccccagagctcagggacagtgtacgaagctgccgct
gtggaagtggatgtatctgcttccatcacactgcaagtgctggtcgacgccccagggaac
atttcctgtctctgggtctttaagcacagctccctgaattgccagccacattttgattta
caaaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaagctggagaa
tacctactttttattcagagtgaagctaccaattacacaatattgtttacagtgagtata
agaaataccctgctttacacattaagaagaccttactttagaaaaatggaaaaccaggac
gccctggtctgcatatctgagagcgttccagagccgatcgtggaatgggtgctttgcgat
tcacagggggaaagctgtaaagaagaaagtccagctgttgttaaaaaggaggaaaaagtg
cttcatgaattatttgggacggacataaggtgctgtgccagaaatgaactgggcagggaa
tgcaccaggctgttcacaatagatctaaatcaaactcctcagaccacattgccacaatta
tttcttaaagtaggggaacccttatggataaggtgcaaagctgttcatgtgaaccatgga
ttcgggctcacctgggaattagaaaacaaagcactcgaggagggcaactactttgagatg
agtacctattcaacaaacagaactatgatacggattctgtttgcttttgtatcatcagtg
gcaagaaacgacaccggatactacacttgttcctcttcaaagcatcccagtcaatcagct
ttggttaccatcgtagaaaagggatttataaatgctaccaattcaagtgaagattatgaa
attgaccaatatgaagagttttgtttttctgtcaggtttaaagcctacccacaaatcaga
tgtacgtggaccttctctcgaaaatcatttccttgtgagcaaaagggtcttgataacgga
tacagcatatccaagttttgcaatcataagcaccagccaggagaatatatattccatgca
gaaaatgatgatgcccaatttaccaaaatgttcacgctgaatataagaaggaaacctcaa
gtgctcgcagaagcatcggcaagtcaggcgtcctgtttctcggatggatacccattacca
tcttggacctggaagaagtgttcagacaagtctcccaactgcacagaagagatcacagaa
ggagtctggaatagaaaggctaacagaaaagtgtttggacagtgggtgtcgagcagtact
ctaaacatgagtgaagccataaaagggttcctggtcaagtgctgtgcatacaattccctt
ggcacatcttgtgagacgatccttttaaactctccaggccccttccctttcatccaagac
aacatctcattctatgcaacaattggtgtttgtctcctcttcattgtcgttttaaccctg
ctaatttgtcacaagtacaaaaagcaatttaggtatgaaagccagctacagatggtacag
gtgaccggctcctcagataatgagtacttctacgttgatttcagagaatatgaatatgat
ctcaaatgggagtttccaagagaaaatttagagtttgggaaggtactaggatcaggtgct
tttggaaaagtgatgaacgcaacagcttatggaattagcaaaacaggagtctcaatccag
gttgccgtcaaaatgctgaaagaaaaagcagacagctctgaaagagaggcactcatgtca
gaactcaagatgatgacccagctgggaagccacgagaatattgtgaacctgctgggggcg
tgcacactgtcaggaccaatttacttgatttttgaatactgttgctatggtgatcttctc
aactatctaagaagtaaaagagaaaaatttcacaggacttggacagagattttcaaggaa
cacaatttcagtttttaccccactttccaatcacatccaaattccagcatgcctggttca
agagaagttcagatacacccggactcggatcaaatctcagggcttcatgggaattcattt
cactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaagaagaggaggacttg
aatgtgcttacatttgaagatcttctttgctttgcatatcaagttgccaaaggaatggaa
tttctggaatttaagtcgtgtgttcacagagacctggccgccaggaacgtgcttgtcacc
cacgggaaagtggtgaagatatgtgactttggattggctcgagatatcatgagtgattcc
aactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatggcccccgaaagcctg
tttgaaggcatctacaccattaagagtgatgtctggtcatatggaatattactgtgggaa
atcttctcacttggtgtgaatccttaccctggcattccggttgatgctaacttctacaaa
ctgattcaaaatggatttaaaatggatcagccattttatgctacagaagaaatatacatt
ataatgcaatcctgctgggcttttgactcaaggaaacggccatccttccctaatttgact
tcgtttttaggatgtcagctggcagatgcagaagaagcgatgtatcagaatgtggatggc
cgtgtttcggaatgtcctcacacctaccaaaacaggcgacctttcagcagagagatggat
ttggggctactctctccgcaggctcaggtcgaagattcgtag

DBGET integrated database retrieval system