KEGG   Homo sapiens (human): 23266Help
Entry
23266             CDS       T01001                                 

Gene name
ADGRL2, CIRL2, CL2, LEC1, LPHH1, LPHN2
Definition
(RefSeq) adhesion G protein-coupled receptor L2
  KO
K04593  
latrophilin 2
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Other
   Latrophilin
    23266 (ADGRL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p31.1
AA seq 1403 aa AA seqDB search
MVSSGCRMRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIE
SANYGRTDDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSDVFPDPCPGTY
KYLEVQYECVPYIFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRT
DTLIEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKS
GEAIINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEA
TWETVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNRGEYVDVPFPN
QYQYIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTIIST
TSTTSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPITNIFPLPERFCEALDSKGIKWP
QTQRGMMVERPCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAA
SLANELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKAIVDTV
DNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVSMPTENIVLEVA
VLSTEGQIQDFKFPLGIKGAGSSIQLSANTVKQNSRNGLAKLVFIIYRSLGQFLSTENAT
IKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDPDNYFNANCSFWNY
SERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKDGVHELLLTVITWV
GIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGIDKTKYAIACPIF
AGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPATVVGVSAAIDY
KSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHSNTLKPDSSRLENI
KSWVLGAFALLCLLGLTWSFGLLFINEETIVMAYLFTIFNAFQGVFIFIFHCALQKKVRK
EYGKCFRHSYCCGGLPTESPHSSVKASTTRTSARYSSGTQSRIRRMWNDTVRKQSESSFI
SGDINSTSTLNQGHSLNNARDTSAMDTLPLNGNFNNSYSLHKGDYNDSVQVVDCGLSLND
TAFEKMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASSLMHSDNPGL
ELHHKELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQSPNRDSLYTSMP
NLRDSPYPESSPDMEEDLSPSRRSENEDIYYKSMPNLGAGHQLQMCYQISRGNSDGYIIP
INKEGCIPEGDVREGQMQLVTSL
NT seq 4212 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcttctggttgcagaatgcgaagtctgtggtttatcattgtaatcagcttctta
ccaaatacagaaggtttcagcagagcagctttaccatttgggctggtgaggcgagaatta
tcctgtgaaggttattctatagatctgcgatgcccgggcagtgatgtcatcatgattgag
agcgctaactatggtcggacggatgacaagatttgtgatgctgacccatttcagatggag
aatacagactgctacctccccgatgccttcaaaattatgactcaaaggtgcaacaatcga
acacagtgtatagtagttactgggtcagatgtgtttcctgatccatgtcctggaacatac
aaataccttgaagtccaatatgaatgtgtcccttacatttttgtgtgtcctgggaccttg
aaagcaattgtggactcaccatgtatatatgaagctgaacaaaaggcgggtgcttggtgc
aaggaccctcttcaggctgcagataaaatttatttcatgccctggactccctatcgtacc
gatactttaatagaatatgcttctttagaagatttccaaaatagtcgccaaacaacaaca
tataaacttccaaatcgagtagatggtactggatttgtggtgtatgatggtgctgtcttc
tttaacaaagaaagaacgaggaatattgtgaaatttgacttgaggactagaattaagagt
ggcgaggccataattaactatgccaactaccatgatacctcaccatacagatggggagga
aagactgatatcgacctagcagttgatgaaaatggtttatgggtcatttacgccactgaa
cagaacaatggaatgatagttattagccagctgaatccatacactcttcgatttgaagca
acgtgggagactgtatacgacaaacgtgccgcatcaaatgcttttatgatatgcggagtc
ctctatgtggttaggtcagtttatcaagacaatgaaagtgaaacaggcaagaactcaatt
gattacatttataatacccgattaaaccgaggagaatatgtagatgttcccttccccaac
cagtatcagtatattgctgcagtggattacaatccaagagataaccaactttacgtgtgg
aacaataacttcattttacgatattctctggagtttggtccacctgatcctgcccaagtg
cctaccacagctgtgacaataacttcttcagctgagctgttcaaaaccataatatcaacc
acaagcactacttcacagaaaggccccatgagcacaactgtagctggatcacaggaagga
agcaaagggacaaaaccacctccagcagtttctacaaccaaaattccacctataacaaat
atttttcccctgccagagagattctgtgaagcattagactccaaggggataaagtggcct
cagacacaaaggggaatgatggttgaacgaccatgccctaagggaacaagaggaactgcc
tcatatctctgcatgatttccactggaacatggaaccctaagggccccgatcttagcaac
tgtacctcacactgggtgaatcagctggctcagaagatcagaagcggagaaaatgctgct
agtcttgccaatgaactggctaaacataccaaagggccagtgtttgctggggatgtaagt
tcttcagtgagattgatggagcagttggtggacatccttgatgcacagctgcaggaactg
aaacctagtgaaaaagattcagctggacggagttataacaaggcaattgttgacacagtg
gacaaccttctgagacccgaagctttggaatcatggaaacatatgaattcttctgaacaa
gcacatactgcaacaatgttactcgatacattggaagaaggagcttttgtcctagctgac
aatcttttagaaccaacaagggtctcaatgcccacagaaaatattgtcctggaagttgcc
gtactcagtacagaaggacagatccaagactttaaatttcctctgggcatcaaaggagca
ggcagctcaatccaactgtccgcaaataccgtcaaacagaacagcaggaatgggcttgca
aagttggtgttcatcatttaccggagcctgggacagttccttagtacagaaaatgcaacc
attaaactgggtgctgattttattggtcgtaatagcaccattgcagtgaactctcacgtc
atttcagtttcaatcaataaagagtccagccgagtatacctgactgatcctgtgcttttt
accctgccacacattgatcctgacaattatttcaatgcaaactgctccttctggaactac
tcagagagaactatgatgggatattggtctacccagggctgcaagctggttgacactaat
aaaactcgaacaacgtgtgcatgcagccacctaaccaattttgcaattctcatggcccac
agggaaattgcatataaagatggcgttcatgaattacttcttacagtcatcacctgggtg
ggaattgtcatttcccttgtttgcctggctatctgcatcttcaccttctgctttttccgt
ggcctacagagtgaccgaaatactattcacaagaacctttgtatcaaccttttcattgct
gaatttattttcctaataggcattgataagacaaaatatgcgattgcatgcccaatattt
gcaggacttctacactttttctttttggcagcttttgcttggatgtgcctagaaggtgtg
cagctctacctaatgttagttgaagtttttgaaagtgaatattcaaggaaaaaatattac
tatgttgctggttacttgtttcctgccacagtggttggagtttcagctgctattgactat
aagagctatggaacagaaaaagcttgctggcttcatgttgataactactttatatggagc
ttcattggacctgttaccttcattattctgctaaatattatcttcttggtgatcacattg
tgcaaaatggtgaagcattcaaacactttgaaaccagattctagcaggttggaaaacatt
aagtcttgggtgcttggcgctttcgctcttctgtgtcttcttggcctcacctggtccttt
gggttgctttttattaatgaggagactattgtgatggcatatctcttcactatatttaat
gctttccagggagtgttcattttcatctttcactgtgctctccaaaagaaagtacgaaaa
gaatatggcaagtgcttcagacactcatactgctgtggaggcctcccaactgagagtccc
cacagttcagtgaaggcatcaaccaccagaaccagtgctcgctattcctctggcacacag
agtcgtataagaagaatgtggaatgatactgtgagaaaacaatcagaatcttcttttatc
tcaggtgacatcaatagcacttcaacacttaatcaaggacattcactgaacaatgccagg
gatacaagtgccatggatactctaccgctaaatggtaattttaacaacagctactcgctg
cacaagggtgactataatgacagcgtgcaagttgtggactgtggactaagtctgaatgat
actgcttttgagaaaatgatcatttcagaattagtgcacaacaacttacggggcagcagc
aagactcacaacctcgagctcacgctaccagtcaaacctgtgattggaggtagcagcagt
gaagatgatgctattgtggcagatgcttcatctttaatgcacagcgacaacccagggctg
gagctccatcacaaagaactcgaggcaccacttattcctcagcggactcactcccttctg
taccaaccccagaagaaagtgaagtccgagggaactgacagctatgtctcccaactgaca
gcagaggctgaagatcacctacagtcccccaacagagactctctttatacaagcatgccc
aatcttagagactctccctatccggagagcagccctgacatggaagaagacctctctccc
tccaggaggagtgagaatgaggacatttactataaaagcatgccaaatcttggagctggc
catcagcttcagatgtgctaccagatcagcaggggcaatagtgatggttatataatcccc
attaacaaagaagggtgtattccagaaggagatgttagagaaggacaaatgcagctggtt
acaagtctttaa

DBGET integrated database retrieval system