KEGG   Homo sapiens (human): 2335Help
Entry
2335              CDS       T01001                                 

Gene name
FN1, CIG, ED-B, FINC, FN, FNZ, GFND, GFND2, LETS, MSF
Definition
(RefSeq) fibronectin 1
  KO
K05717  
fibronectin 1
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Amoebiasis
Pathways in cancer
Proteoglycans in cancer
Small cell lung cancer
Disease
H01260  
Glomerulopathy with fibronectin deposits (GFND)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    2335 (FN1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    2335 (FN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    2335 (FN1)
  Cellular commiunity
   04510 Focal adhesion
    2335 (FN1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2335 (FN1)
   05205 Proteoglycans in cancer
    2335 (FN1)
   05222 Small cell lung cancer
    2335 (FN1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    2335 (FN1)
   05146 Amoebiasis
    2335 (FN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   2335 (FN1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   2335 (FN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q34
AA seq 2446 aa AA seqDB search
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSV
GYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAP
PPSIDLTNFLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYVVSVSSVYEQHESTP
LRGRQKTGLDSPTGIDFSDITANSFTVHWIAPRATITGYRIRHHPEHFSGRPREDRVPHS
RNSITLTNLTPGTEYVVSIVALNGREESPLLIGQQSTVSDVPRDLEVVAATPTSLLISWD
APAVTVRYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPA
SSKPISINYRTEIDKPSQMQVTDVQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKT
AGPDQTEMTIEGLQPTVEYVVSVYAQNPSGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGSPPREVVP
RPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFVTHPGYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLT
GLTRGATYNIIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDE
WERMSESGFKLLCQCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLG
NGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEP
SPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
NT seq 7341 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggggtccggggcccgggctgctgctgctggccgtccagtgcctggggacagcg
gtgccctccacgggagcctcgaagagcaagaggcaggctcagcaaatggttcagccccag
tccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctaggcaatgcgttggtttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactgggaacacttaccgagtgggtgacacttatgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgtaccatcgcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacatgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaagtgttttgatcatgctgctgggacttcctatgtggtcggagaaacg
tgggagaagccctaccaaggctggatgatggtagattgtacttgcctgggagaaggcagc
ggacgcatcacttgcacttctagaaatagatgcaacgatcaggacacaaggacatcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgagaggcacacctctgtgcagaccacatcg
agcggatctggccccttcaccgatgttcgtgcagctgtttaccaaccgcagcctcacccc
cagcctcctccctatggccactgtgtcacagacagtggtgtggtctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcacgtgcctgggcaacggagtc
agctgccaagagacagctgtaacccagacttacggtggcaactcaaatggagagccatgt
gtcttaccattcacctacaatggcaggacgttctactcctgcaccacagaagggcgacag
gacggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatactctttc
tgcacagaccacactgttttggttcagactcgaggaggaaattccaatggtgccttgtgc
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcagaaga
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttgggttc
tgccccatggctgcccacgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggtcacatgatgaggtgcacgtgtgttggg
aatggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaacgacacattccacaagcgtcatgaagaggggcacatg
ctgaactgtacatgcttcggtcagggtcggggcaggtggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacgttttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgagactccg
agtcagcccaactcccaccccatccagtggaatgcaccacagccatctcacatttccaag
tacattctcaggtggagacctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccaagaagtgactcgctttgacttcaccaccacc
agcaccagcacacctgtgaccagcaacaccgtgacaggagagacgactcccttttctcct
cttgtggccacttctgaatctgtgaccgaaatcacagccagtagctttgtggtctcctgg
gtctcagcttccgacaccgtgtcgggattccgggtggaatatgagctgagtgaggaggga
gatgagccacagtacctggatcttccaagcacagccacttctgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcctgatgcccctcctgacccgactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaggctcccatcacaggg
tacagaatagtctattcgccatcagtagaaggtagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgacttgcaacctggtgttcagtataacatcactatc
tatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaaccactggc
accccacgctcagatacagtgccctctcccagggacctgcagtttgtggaagtgacagac
gtgaaggtcaccatcatgtggacaccgcctgagagtgcagtgaccggctaccgtgtggat
gtgatccccgtcaacctgcctggcgagcacgggcagaggctgcccatcagcaggaacacc
tttgcagaagtcaccgggctgtcccctggggtcacctattacttcaaagtctttgcagtg
agccatgggagggagagcaagcctctgactgctcaacagacaaccaaactggatgctccc
actaacctccagtttgtcaatgaaactgattctactgtcctggtgagatggactccacct
cgggcccagataacaggataccgactgaccgtgggccttacccgaagaggacagcccagg
cagtacaatgtgggtccctctgtctccaagtacccactgaggaatctgcagcctgcatct
gagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagccactgga
gtctttaccacactgcagcctgggagctctattccaccttacaacaccgaggtgactgag
accaccattgtgatcacatggacgcctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccacgagaagtgacttcagactcaggaagcatcgttgtg
tccggcttgactccaggagtagaatacgtctacaccatccaagtcctgagagatggacag
gaaagagatgcgccaattgtaaacaaagtggtgacaccattgtctccaccaacaaacttg
catctggaggcaaaccctgacactggagtgctcacagtctcctgggagaggagcaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggaaattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggc
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagaggtgccccaactcactgacctaagctttgttgatataaccgat
tcaagcatcggcctgaggtggaccccgctaaactcttccaccattattgggtaccgcatc
acagtagttgcggcaggagaaggtatccctatttttgaagattttgtggactcctcagta
ggatactacacagtcacagggctggagccgggcattgactatgatatcagcgttatcact
ctcattaatggcggcgagagtgcccctactacactgacacaacaaacggctgttcctcct
cccactgacctgcgattcaccaacattggtccagacaccatgcgtgtcacctgggctcca
cccccatccattgatttaaccaacttcctggtgcgttactcacctgtgaaaaatgaggaa
gatgttgcagagttgtcaatttctccttcagacaatgcagtggtcttaacaaatctcctg
cctggtacagaatatgtagtgagtgtctccagtgtctacgaacaacatgagagcacacct
cttagaggaagacagaaaacaggtcttgattccccaactggcattgacttttctgatatt
actgccaactcttttactgtgcactggattgctcctcgagccaccatcactggctacagg
atccgccatcatcccgagcacttcagtgggagacctcgagaagatcgggtgccccactct
cggaattccatcaccctcaccaacctcactccaggcacagagtatgtggtcagcatcgtt
gctcttaatggcagagaggaaagtcccttattgattggccaacaatcaacagtttctgat
gttccgagggacctggaagttgttgctgcgacccccaccagcctactgatcagctgggat
gctcctgctgtcacagtgagatattacaggatcacttacggagagacaggaggaaatagc
cctgtccaggagttcactgtgcctgggagcaagtctacagctaccatcagcggccttaaa
cctggagttgattataccatcactgtgtatgctgtcactggccgtggagacagccccgca
agcagcaagccaatttccattaattaccgaacagaaattgacaaaccatcccagatgcaa
gtgaccgatgttcaggacaacagcattagtgtcaagtggctgccttcaagttcccctgtt
actggttacagagtaaccaccactcccaaaaatggaccaggaccaacaaaaactaaaact
gcaggtccagatcaaacagaaatgactattgaaggcttgcagcccacagtggagtatgtg
gttagtgtctatgctcagaatccaagcggagagagtcagcctctggttcagactgcagta
accaacattgatcgccctaaaggactggcattcactgatgtggatgtcgattccatcaaa
attgcttgggaaagcccacaggggcaagtttccaggtacagggtgacctactcgagccct
gaggatggaatccatgagctattccctgcacctgatggtgaagaagacactgcagagctg
caaggcctcagaccgggttctgagtacacagtcagtgtggttgccttgcacgatgatatg
gagagccagcccctgattggaacccagtccacagctattcctgcaccaactgacctgaag
ttcactcaggtcacacccacaagcctgagcgcccagtggacaccacccaatgttcagctc
actggatatcgagtgcgggtgacccccaaggagaagaccggaccaatgaaagaaatcaac
cttgctcctgacagctcatccgtggttgtatcaggacttatggtggccaccaaatatgaa
gtgagtgtctatgctcttaaggacactttgacaagcagaccagctcagggagttgtcacc
actctggagaatgtcagcccaccaagaagggctcgtgtgacagatgctactgagaccacc
atcaccattagctggagaaccaagactgagacgatcactggcttccaagttgatgccgtt
ccagccaatggccagactccaatccagagaaccatcaagccagatgtcagaagctacacc
atcacaggtttacaaccaggcactgactacaagatctacctgtacaccttgaatgacaat
gctcggagctcccctgtggtcatcgacgcctccactgccattgatgcaccatccaacctg
cgtttcctggccaccacacccaattccttgctggtatcatggcagccgccacgtgccagg
attaccggctacatcatcaagtatgagaagcctgggtctcctcccagagaagtggtccct
cggccccgccctggtgtcacagaggctactattactggcctggaaccgggaaccgaatat
acaatttatgtcattgccctgaagaataatcagaagagcgagcccctgattggaaggaaa
aagacagacgagcttccccaactggtaacccttccacaccccaatcttcatggaccagag
atcttggatgttccttccacagttcaaaagacccctttcgtcacccaccctgggtatgac
actggaaatggtattcagcttcctggcacttctggtcagcaacccagtgttgggcaacaa
atgatctttgaggaacatggttttaggcggaccacaccgcccacaacggccacccccata
aggcataggccaagaccatacccgccgaatgtaggacaagaagctctctctcagacaacc
atctcatgggccccattccaggacacttctgagtacatcatttcatgtcatcctgttggc
actgatgaagaacccttacagttcagggttcctggaacttctaccagtgccactctgaca
ggcctcaccagaggtgccacctacaacatcatagtggaggcactgaaagaccagcagagg
cataaggttcgggaagaggttgttaccgtgggcaactctgtcaacgaaggcttgaaccaa
cctacggatgactcgtgctttgacccctacacagtttcccattatgccgttggagatgag
tgggaacgaatgtctgaatcaggctttaaactgttgtgccagtgcttaggctttggaagt
ggtcatttcagatgtgattcatctagatggtgccatgacaatggtgtgaactacaagatt
ggagagaagtgggaccgtcagggagaaaatggccagatgatgagctgcacatgtcttggg
aacggaaaaggagaattcaagtgtgaccctcatgaggcaacgtgttatgatgatgggaag
acataccacgtaggagaacagtggcagaaggaatatctcggtgccatttgctcctgcaca
tgctttggaggccagcggggctggcgctgtgacaactgccgcagacctgggggtgaaccc
agtcccgaaggcactactggccagtcctacaaccagtattctcagagataccatcagaga
acaaacactaatgttaattgcccaattgagtgcttcatgcctttagatgtacaggctgac
agagaagattcccgagagtaa

DBGET integrated database retrieval system