KEGG   Homo sapiens (human): 2335Help
Entry
2335              CDS       T01001                                 

Gene name
FN1, CIG, ED-B, FINC, FN, FNZ, GFND, GFND2, LETS, MSF, SMDCF
Definition
(RefSeq) fibronectin 1
  KO
K05717  fibronectin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04810  Regulation of actin cytoskeleton
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05100  Bacterial invasion of epithelial cells
hsa05146  Amoebiasis
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
Disease
H01260  Glomerulopathy with fibronectin deposits (GFND)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    2335 (FN1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    2335 (FN1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    2335 (FN1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2335 (FN1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2335 (FN1)
   05205 Proteoglycans in cancer
    2335 (FN1)
   05222 Small cell lung cancer
    2335 (FN1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    2335 (FN1)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    2335 (FN1)
   05165 Human papillomavirus infection
    2335 (FN1)
   05146 Amoebiasis
    2335 (FN1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    2335 (FN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   2335 (FN1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   2335 (FN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369
Motif
Other DBs
NCBI-GeneID: 2335
NCBI-ProteinID: NP_002017
OMIM: 135600
HGNC: 3778
Ensembl: ENSG00000115414
Vega: OTTHUMG00000133054
Pharos: P02751(Tchem)
UniProt: P02751 Q6MZF4 Q6N084
Structure
PDB: 

Jmol
Position
2q35
AA seq 2355 aa AA seqDB search
MLRGPGPGLLLLAVQCLGTAVPSTGASKSKRQAQQMVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTSVQTTSSGSGPFTDVRAAVYQPQPHP
QPPPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVEVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHQEVTRFDFTTTSTSTPVTSNTVTGETTPFSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITG
YRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTG
TPRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNT
FAEVTGLSPGVTYYFKVFAVSHGRESKPLTAQQTTKLDAPTNLQFVNETDSTVLVRWTPP
RAQITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPASEYTVSLVAIKGNQESPKATG
VFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVV
SGLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLEANPDTGVLTVSWERSTT
PDITGYRITTTPTNGQQGNSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPIS
DTIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSD
NAVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIA
PRATITGYRIRHHPEHFSGRPREDRVPHSRNSITLTNLTPGTEYVVSIVALNGREESPLL
IGQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSK
STATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISV
KWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNPSGE
SQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAP
DGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSA
QWTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLT
SRPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPIQRT
IKPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLL
VSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQ
KSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFVTHPGYDTGNGIQLPGTS
GQQPSVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGQEALSQTTISWAPFQDTSE
YIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQQRHKVREEVVTVG
NSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCQCLGFGSGHFRCDSSRWC
HDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKE
YLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIEC
FMPLDVQADREDSRE
NT seq 7068 nt NT seq  +upstreamnt  +downstreamnt
atgcttaggggtccggggcccgggctgctgctgctggccgtccagtgcctggggacagcg
gtgccctccacgggagcctcgaagagcaagaggcaggctcagcaaatggttcagccccag
tccccggtggctgtcagtcaaagcaagcccggttgttatgacaatggaaaacactatcag
ataaatcaacagtgggagcggacctacctaggcaatgcgttggtttgtacttgttatgga
ggaagccgaggttttaactgcgagagtaaacctgaagctgaagagacttgctttgacaag
tacactgggaacacttaccgagtgggtgacacttatgagcgtcctaaagactccatgatc
tgggactgtacctgcatcggggctgggcgagggagaataagctgtaccatcgcaaaccgc
tgccatgaagggggtcagtcctacaagattggtgacacctggaggagaccacatgagact
ggtggttacatgttagagtgtgtgtgtcttggtaatggaaaaggagaatggacctgcaag
cccatagctgagaagtgttttgatcatgctgctgggacttcctatgtggtcggagaaacg
tgggagaagccctaccaaggctggatgatggtagattgtacttgcctgggagaaggcagc
ggacgcatcacttgcacttctagaaatagatgcaacgatcaggacacaaggacatcctat
agaattggagacacctggagcaagaaggataatcgaggaaacctgctccagtgcatctgc
acaggcaacggccgaggagagtggaagtgtgagaggcacacctctgtgcagaccacatcg
agcggatctggccccttcaccgatgttcgtgcagctgtttaccaaccgcagcctcacccc
cagcctcctccctatggccactgtgtcacagacagtggtgtggtctactctgtggggatg
cagtggctgaagacacaaggaaataagcaaatgctttgcacgtgcctgggcaacggagtc
agctgccaagagacagctgtaacccagacttacggtggcaactcaaatggagagccatgt
gtcttaccattcacctacaatggcaggacgttctactcctgcaccacagaagggcgacag
gacggacatctttggtgcagcacaacttcgaattatgagcaggaccagaaatactctttc
tgcacagaccacactgttttggttcagactcgaggaggaaattccaatggtgccttgtgc
cacttccccttcctatacaacaaccacaattacactgattgcacttctgagggcagaaga
gacaacatgaagtggtgtgggaccacacagaactatgatgccgaccagaagtttgggttc
tgccccatggctgcccacgaggaaatctgcacaaccaatgaaggggtcatgtaccgcatt
ggagatcagtgggataagcagcatgacatgggtcacatgatgaggtgcacgtgtgttggg
aatggtcgtggggaatggacatgcattgcctactcgcagcttcgagatcagtgcattgtt
gatgacatcacttacaatgtgaacgacacattccacaagcgtcatgaagaggggcacatg
ctgaactgtacatgcttcggtcagggtcggggcaggtggaagtgtgatcccgtcgaccaa
tgccaggattcagagactgggacgttttatcaaattggagattcatgggagaagtatgtg
catggtgtcagataccagtgctactgctatggccgtggcattggggagtggcattgccaa
cctttacagacctatccaagctcaagtggtcctgtcgaagtatttatcactgagactccg
agtcagcccaactcccaccccatccagtggaatgcaccacagccatctcacatttccaag
tacattctcaggtggagacctaaaaattctgtaggccgttggaaggaagctaccatacca
ggccacttaaactcctacaccatcaaaggcctgaagcctggtgtggtatacgagggccag
ctcatcagcatccagcagtacggccaccaagaagtgactcgctttgacttcaccaccacc
agcaccagcacacctgtgaccagcaacaccgtgacaggagagacgactcccttttctcct
cttgtggccacttctgaatctgtgaccgaaatcacagccagtagctttgtggtctcctgg
gtctcagcttccgacaccgtgtcgggattccgggtggaatatgagctgagtgaggaggga
gatgagccacagtacctggatcttccaagcacagccacttctgtgaacatccctgacctg
cttcctggccgaaaatacattgtaaatgtctatcagatatctgaggatggggagcagagt
ttgatcctgtctacttcacaaacaacagcgcctgatgcccctcctgacccgactgtggac
caagttgatgacacctcaattgttgttcgctggagcagaccccaggctcccatcacaggg
tacagaatagtctattcgccatcagtagaaggtagcagcacagaactcaaccttcctgaa
actgcaaactccgtcaccctcagtgacttgcaacctggtgttcagtataacatcactatc
tatgctgtggaagaaaatcaagaaagtacacctgttgtcattcaacaagaaaccactggc
accccacgctcagatacagtgccctctcccagggacctgcagtttgtggaagtgacagac
gtgaaggtcaccatcatgtggacaccgcctgagagtgcagtgaccggctaccgtgtggat
gtgatccccgtcaacctgcctggcgagcacgggcagaggctgcccatcagcaggaacacc
tttgcagaagtcaccgggctgtcccctggggtcacctattacttcaaagtctttgcagtg
agccatgggagggagagcaagcctctgactgctcaacagacaaccaaactggatgctccc
actaacctccagtttgtcaatgaaactgattctactgtcctggtgagatggactccacct
cgggcccagataacaggataccgactgaccgtgggccttacccgaagaggacagcccagg
cagtacaatgtgggtccctctgtctccaagtacccactgaggaatctgcagcctgcatct
gagtacaccgtatccctcgtggccataaagggcaaccaagagagccccaaagccactgga
gtctttaccacactgcagcctgggagctctattccaccttacaacaccgaggtgactgag
accaccattgtgatcacatggacgcctgctccaagaattggttttaagctgggtgtacga
ccaagccagggaggagaggcaccacgagaagtgacttcagactcaggaagcatcgttgtg
tccggcttgactccaggagtagaatacgtctacaccatccaagtcctgagagatggacag
gaaagagatgcgccaattgtaaacaaagtggtgacaccattgtctccaccaacaaacttg
catctggaggcaaaccctgacactggagtgctcacagtctcctgggagaggagcaccacc
ccagacattactggttatagaattaccacaacccctacaaacggccagcagggaaattct
ttggaagaagtggtccatgctgatcagagctcctgcacttttgataacctgagtcccggc
ctggagtacaatgtcagtgtttacactgtcaaggatgacaaggaaagtgtccctatctct
gataccatcatcccagctgttcctcctcccactgacctgcgattcaccaacattggtcca
gacaccatgcgtgtcacctgggctccacccccatccattgatttaaccaacttcctggtg
cgttactcacctgtgaaaaatgaggaagatgttgcagagttgtcaatttctccttcagac
aatgcagtggtcttaacaaatctcctgcctggtacagaatatgtagtgagtgtctccagt
gtctacgaacaacatgagagcacacctcttagaggaagacagaaaacaggtcttgattcc
ccaactggcattgacttttctgatattactgccaactcttttactgtgcactggattgct
cctcgagccaccatcactggctacaggatccgccatcatcccgagcacttcagtgggaga
cctcgagaagatcgggtgccccactctcggaattccatcaccctcaccaacctcactcca
ggcacagagtatgtggtcagcatcgttgctcttaatggcagagaggaaagtcccttattg
attggccaacaatcaacagtttctgatgttccgagggacctggaagttgttgctgcgacc
cccaccagcctactgatcagctgggatgctcctgctgtcacagtgagatattacaggatc
acttacggagagacaggaggaaatagccctgtccaggagttcactgtgcctgggagcaag
tctacagctaccatcagcggccttaaacctggagttgattataccatcactgtgtatgct
gtcactggccgtggagacagccccgcaagcagcaagccaatttccattaattaccgaaca
gaaattgacaaaccatcccagatgcaagtgaccgatgttcaggacaacagcattagtgtc
aagtggctgccttcaagttcccctgttactggttacagagtaaccaccactcccaaaaat
ggaccaggaccaacaaaaactaaaactgcaggtccagatcaaacagaaatgactattgaa
ggcttgcagcccacagtggagtatgtggttagtgtctatgctcagaatccaagcggagag
agtcagcctctggttcagactgcagtaaccaacattgatcgccctaaaggactggcattc
actgatgtggatgtcgattccatcaaaattgcttgggaaagcccacaggggcaagtttcc
aggtacagggtgacctactcgagccctgaggatggaatccatgagctattccctgcacct
gatggtgaagaagacactgcagagctgcaaggcctcagaccgggttctgagtacacagtc
agtgtggttgccttgcacgatgatatggagagccagcccctgattggaacccagtccaca
gctattcctgcaccaactgacctgaagttcactcaggtcacacccacaagcctgagcgcc
cagtggacaccacccaatgttcagctcactggatatcgagtgcgggtgacccccaaggag
aagaccggaccaatgaaagaaatcaaccttgctcctgacagctcatccgtggttgtatca
ggacttatggtggccaccaaatatgaagtgagtgtctatgctcttaaggacactttgaca
agcagaccagctcagggagttgtcaccactctggagaatgtcagcccaccaagaagggct
cgtgtgacagatgctactgagaccaccatcaccattagctggagaaccaagactgagacg
atcactggcttccaagttgatgccgttccagccaatggccagactccaatccagagaacc
atcaagccagatgtcagaagctacaccatcacaggtttacaaccaggcactgactacaag
atctacctgtacaccttgaatgacaatgctcggagctcccctgtggtcatcgacgcctcc
actgccattgatgcaccatccaacctgcgtttcctggccaccacacccaattccttgctg
gtatcatggcagccgccacgtgccaggattaccggctacatcatcaagtatgagaagcct
gggtctcctcccagagaagtggtccctcggccccgccctggtgtcacagaggctactatt
actggcctggaaccgggaaccgaatatacaatttatgtcattgccctgaagaataatcag
aagagcgagcccctgattggaaggaaaaagacagacgagcttccccaactggtaaccctt
ccacaccccaatcttcatggaccagagatcttggatgttccttccacagttcaaaagacc
cctttcgtcacccaccctgggtatgacactggaaatggtattcagcttcctggcacttct
ggtcagcaacccagtgttgggcaacaaatgatctttgaggaacatggttttaggcggacc
acaccgcccacaacggccacccccataaggcataggccaagaccatacccgccgaatgta
ggacaagaagctctctctcagacaaccatctcatgggccccattccaggacacttctgag
tacatcatttcatgtcatcctgttggcactgatgaagaacccttacagttcagggttcct
ggaacttctaccagtgccactctgacaggcctcaccagaggtgccacctacaacatcata
gtggaggcactgaaagaccagcagaggcataaggttcgggaagaggttgttaccgtgggc
aactctgtcaacgaaggcttgaaccaacctacggatgactcgtgctttgacccctacaca
gtttcccattatgccgttggagatgagtgggaacgaatgtctgaatcaggctttaaactg
ttgtgccagtgcttaggctttggaagtggtcatttcagatgtgattcatctagatggtgc
catgacaatggtgtgaactacaagattggagagaagtgggaccgtcagggagaaaatggc
cagatgatgagctgcacatgtcttgggaacggaaaaggagaattcaagtgtgaccctcat
gaggcaacgtgttatgatgatgggaagacataccacgtaggagaacagtggcagaaggaa
tatctcggtgccatttgctcctgcacatgctttggaggccagcggggctggcgctgtgac
aactgccgcagacctgggggtgaacccagtcccgaaggcactactggccagtcctacaac
cagtattctcagagataccatcagagaacaaacactaatgttaattgcccaattgagtgc
ttcatgcctttagatgtacaggctgacagagaagattcccgagagtaa

DBGET integrated database retrieval system