KEGG   Homo sapiens (human): 23385Help
Entry
23385             CDS       T01001                                 

Gene name
NCSTN, ATAG1874
Definition
(RefSeq) nicastrin
  KO
K06171  nicastrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05010  Alzheimer's disease
Module
hsa_M00682  Notch signaling
Disease
H00681  Acne inversa
Drug target
Avagacestat: D09869
Begacestat: D08869
Semagacestat: D09377
Tarenflurbil: D09010
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    23385 (NCSTN)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    23385 (NCSTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nicastrin Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 23385
NCBI-ProteinID: NP_056146
OMIM: 605254
HGNC: 17091
Ensembl: ENSG00000162736
Vega: OTTHUMG00000033110
Pharos: Q92542(Tbio)
UniProt: Q92542
Structure
PDB: 

Jmol
Position
1q23.2
AA seq 709 aa AA seqDB search
MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI
GCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAG
LAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPI
FLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVA
SFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVD
SFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ
PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQ
DLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLY
EYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARI
FLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggctacggcagggggtggctctggggctgacccgggaagtcggggtctccttcgcctt
ctgtctttctgcgtcctactagcaggtttgtgcaggggaaactcagtggagaggaagata
tatatccccttaaataaaacagctccctgtgttcgcctgctcaacgccactcatcagatt
ggctgccagtcttcaattagtggagacacaggggttatccacgtagtagagaaagaggag
gacctacagtgggtattgactgatggccccaaccccccttacatggttctgctggagagc
aagcattttaccagggatttaatggagaagctgaaagggagaaccagccgaattgctggt
cttgcagtgtccttgaccaagcccagtcctgcctcaggcttctctcctagtgtacagtgc
ccaaatgatgggtttggtgtttactccaattcctatgggccagagtttgctcactgcaga
gaaatacagtggaattcgctgggcaatggtttggcttatgaagactttagtttccccatc
tttcttcttgaagatgaaaatgaaaccaaagtcatcaagcagtgctatcaagatcacaac
ctgagtcagaatggctcagcaccaaccttcccactatgtgccatgcagctcttttcacac
atgcatgctgtcatcagcactgccacctgcatgcggcgcagctccatccaaagcaccttc
agcatcaacccagaaatcgtctgtgaccccctgtctgattacaatgtgtggagcatgcta
aagcctataaatacaactgggacattaaagcctgacgacagggttgtggttgctgccacc
cggctggatagtcgttcctttttctggaatgtggccccaggggctgaaagcgcagtggct
tcctttgtcacccagctggctgctgctgaagctttgcaaaaggcacctgatgtgaccacc
ctgccccgcaatgtcatgtttgtcttctttcaaggggaaacttttgactacattggcagc
tcgaggatggtctacgatatggagaagggcaagtttcccgtgcagttagagaatgttgac
tcatttgtggagctgggacaggtggccttaagaacttcattagagctttggatgcacaca
gatcctgtttctcagaaaaatgagtctgtacggaaccaggtggaggatctcctggccaca
ttggagaagagtggtgctggtgtccctgctgtcatcctcaggaggccaaatcagtcccag
cctctcccaccatcttccctgcagcgatttcttcgagctcgaaacatctctggcgttgtt
ctggctgaccactctggtgccttccataacaaatattaccagagtatttacgacactgct
gagaacattaatgtgagctatcccgaatggctgagccctgaagaggacctgaactttgta
acagacactgccaaggccctggcagatgtggccacggtgctgggacgtgctctgtatgag
cttgcaggaggaaccaacttcagcgacacagttcaggctgatccccaaacggttacccgc
ctgctctatgggttcctgattaaagccaacaactcatggttccagtctatcctcaggcag
gacctaaggtcctacttgggtgacgggcctcttcaacattacatcgctgtctccagcccc
accaacaccacttatgttgtacagtatgccttggcaaatttgactggcacagtggtcaac
ctcacccgagagcagtgccaggatccaagtaaagtcccaagtgaaaacaaggatctgtat
gagtactcatgggtccagggccctttgcattctaatgagacggaccgactcccccggtgt
gtgcgttctactgcacgattagccagggccttgtctcctgcctttgaactgagtcagtgg
agctctactgaatactctacatggactgagagccgctggaaagatatccgtgcccggata
tttctcatcgccagcaaagagcttgagttgatcaccctgacagtgggcttcggcatcctc
atcttctccctcatcgtcacctactgcatcaatgccaaagctgatgtccttttcattgct
ccccgggagccaggagctgtgtcatactga

DBGET integrated database retrieval system