KEGG   Homo sapiens (human): 23385Help
Entry
23385             CDS       T01001                                 

Gene name
NCSTN, APH2
Definition
nicastrin
Orthology
K06171  
nicastrin
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Alzheimer's disease
Disease
H00681  
Acne inversa
Drug target
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:hsa04330]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q22-q23
AA seq 709 aa AA seqDB search
MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI
GCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAG
LAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPI
FLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVA
SFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVD
SFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ
PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQ
DLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLY
EYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARI
FLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggctacggcagggggtggctctggggctgacccgggaagtcggggtctccttcgcctt
ctgtctttctgcgtcctactagcaggtttgtgcaggggaaactcagtggagaggaagata
tatatccccttaaataaaacagctccctgtgttcgcctgctcaacgccactcatcagatt
ggctgccagtcttcaattagtggagacacaggggttatccacgtagtagagaaagaggag
gacctacagtgggtattgactgatggccccaaccccccttacatggttctgctggagagc
aagcattttaccagggatttaatggagaagctgaaagggagaaccagccgaattgctggt
cttgcagtgtccttgaccaagcccagtcctgcctcaggcttctctcctagtgtacagtgc
ccaaatgatgggtttggtgtttactccaattcctatgggccagagtttgctcactgcaga
gaaatacagtggaattcgctgggcaatggtttggcttatgaagactttagtttccccatc
tttcttcttgaagatgaaaatgaaaccaaagtcatcaagcagtgctatcaagatcacaac
ctgagtcagaatggctcagcaccaaccttcccactatgtgccatgcagctcttttcacac
atgcatgctgtcatcagcactgccacctgcatgcggcgcagctccatccaaagcaccttc
agcatcaacccagaaatcgtctgtgaccccctgtctgattacaatgtgtggagcatgcta
aagcctataaatacaactgggacattaaagcctgacgacagggttgtggttgctgccacc
cggctggatagtcgttcctttttctggaatgtggccccaggggctgaaagcgcagtggct
tcctttgtcacccagctggctgctgctgaagctttgcaaaaggcacctgatgtgaccacc
ctgccccgcaatgtcatgtttgtcttctttcaaggggaaacttttgactacattggcagc
tcgaggatggtctacgatatggagaagggcaagtttcccgtgcagttagagaatgttgac
tcatttgtggagctgggacaggtggccttaagaacttcattagagctttggatgcacaca
gatcctgtttctcagaaaaatgagtctgtacggaaccaggtggaggatctcctggccaca
ttggagaagagtggtgctggtgtccctgctgtcatcctcaggaggccaaatcagtcccag
cctctcccaccatcttccctgcagcgatttcttcgagctcgaaacatctctggcgttgtt
ctggctgaccactctggtgccttccataacaaatattaccagagtatttacgacactgct
gagaacattaatgtgagctatcccgaatggctgagccctgaagaggacctgaactttgta
acagacactgccaaggccctggcagatgtggccacggtgctgggacgtgctctgtatgag
cttgcaggaggaaccaacttcagcgacacagttcaggctgatccccaaacggttacccgc
ctgctctatgggttcctgattaaagccaacaactcatggttccagtctatcctcaggcag
gacctaaggtcctacttgggtgacgggcctcttcaacattacatcgctgtctccagcccc
accaacaccacttatgttgtacagtatgccttggcaaatttgactggcacagtggtcaac
ctcacccgagagcagtgccaggatccaagtaaagtcccaagtgaaaacaaggatctgtat
gagtactcatgggtccagggccctttgcattctaatgagacggaccgactcccccggtgt
gtgcgttctactgcacgattagccagggccttgtctcctgcctttgaactgagtcagtgg
agctctactgaatactctacatggactgagagccgctggaaagatatccgtgcccggata
tttctcatcgccagcaaagagcttgagttgatcaccctgacagtgggcttcggcatcctc
atcttctccctcatcgtcacctactgcatcaatgccaaagctgatgtccttttcattgct
ccccgggagccaggagctgtgtcatactga

DBGET integrated database retrieval system