KEGG   Homo sapiens (human): 23385Help
Entry
23385             CDS       T01001                                 

Gene name
NCSTN, ATAG1874
Definition
nicastrin
Orthology
K06171  
nicastrin
Organism
hsa  Homo sapiens (human)
Pathway
Notch signaling pathway
Alzheimer's disease
Disease
H00681  
Acne inversa
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    23385 (NCSTN)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    23385 (NCSTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q22-q23
AA seq 689 aa AA seqDB search
MDFNLILESLCRGNSVERKIYIPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEE
DLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGLAVSLTKPSPASGFSPSVQC
PNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHN
LSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTFSINPEIVCDPLSDYNVWSML
KPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVASFVTQLAAAEALQKAPDVTT
LPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHT
DPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQPLPPSSLQRFLRARNISGVV
LADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYE
LAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSP
TNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRC
VRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELELITLTVGFGIL
IFSLIVTYCINAKADVLFIAPREPGAVSY
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggactttaatctcattttagaaagtttgtgcaggggaaactcagtggagaggaagata
tatatccccttaaataaaacagctccctgtgttcgcctgctcaacgccactcatcagatt
ggctgccagtcttcaattagtggagacacaggggttatccacgtagtagagaaagaggag
gacctacagtgggtattgactgatggccccaaccccccttacatggttctgctggagagc
aagcattttaccagggatttaatggagaagctgaaagggagaaccagccgaattgctggt
cttgcagtgtccttgaccaagcccagtcctgcctcaggcttctctcctagtgtacagtgc
ccaaatgatgggtttggtgtttactccaattcctatgggccagagtttgctcactgcaga
gaaatacagtggaattcgctgggcaatggtttggcttatgaagactttagtttccccatc
tttcttcttgaagatgaaaatgaaaccaaagtcatcaagcagtgctatcaagatcacaac
ctgagtcagaatggctcagcaccaaccttcccactatgtgccatgcagctcttttcacac
atgcatgctgtcatcagcactgccacctgcatgcggcgcagctccatccaaagcaccttc
agcatcaacccagaaatcgtctgtgaccccctgtctgattacaatgtgtggagcatgcta
aagcctataaatacaactgggacattaaagcctgacgacagggttgtggttgctgccacc
cggctggatagtcgttcctttttctggaatgtggccccaggggctgaaagcgcagtggct
tcctttgtcacccagctggctgctgctgaagctttgcaaaaggcacctgatgtgaccacc
ctgccccgcaatgtcatgtttgtcttctttcaaggggaaacttttgactacattggcagc
tcgaggatggtctacgatatggagaagggcaagtttcccgtgcagttagagaatgttgac
tcatttgtggagctgggacaggtggccttaagaacttcattagagctttggatgcacaca
gatcctgtttctcagaaaaatgagtctgtacggaaccaggtggaggatctcctggccaca
ttggagaagagtggtgctggtgtccctgctgtcatcctcaggaggccaaatcagtcccag
cctctcccaccatcttccctgcagcgatttcttcgagctcgaaacatctctggcgttgtt
ctggctgaccactctggtgccttccataacaaatattaccagagtatttacgacactgct
gagaacattaatgtgagctatcccgaatggctgagccctgaagaggacctgaactttgta
acagacactgccaaggccctggcagatgtggccacggtgctgggacgtgctctgtatgag
cttgcaggaggaaccaacttcagcgacacagttcaggctgatccccaaacggttacccgc
ctgctctatgggttcctgattaaagccaacaactcatggttccagtctatcctcaggcag
gacctaaggtcctacttgggtgacgggcctcttcaacattacatcgctgtctccagcccc
accaacaccacttatgttgtacagtatgccttggcaaatttgactggcacagtggtcaac
ctcacccgagagcagtgccaggatccaagtaaagtcccaagtgaaaacaaggatctgtat
gagtactcatgggtccagggccctttgcattctaatgagacggaccgactcccccggtgt
gtgcgttctactgcacgattagccagggccttgtctcctgcctttgaactgagtcagtgg
agctctactgaatactctacatggactgagagccgctggaaagatatccgtgcccggata
tttctcatcgccagcaaagagcttgagttgatcaccctgacagtgggcttcggcatcctc
atcttctccctcatcgtcacctactgcatcaatgccaaagctgatgtccttttcattgct
ccccgggagccaggagctgtgtcatactga

DBGET integrated database retrieval system