KEGG   Homo sapiens (human): 23405Help
Entry
23405             CDS       T01001                                 

Gene name
DICER1, DCR1, Dicer, Dicer1e, HERNA, K12H4.8-LIKE, MNG1, RMSE2
Definition
(RefSeq) dicer 1, ribonuclease III
  KO
K11592  
endoribonuclease Dicer [EC:3.1.26.-]
Organism
hsa  Homo sapiens (human)
Pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    23405 (DICER1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     23405 (DICER1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  RNA silencing
   RISC (RNA-induced silencing complex)
    23405 (DICER1)
   microRNA pathway
    RISC loading complex
     23405 (DICER1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q32.13
AA seq 1922 aa AA seqDB search
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT
IVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK
VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA
ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL
VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK
QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE
EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDE
DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT
GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP
TEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETD
IDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD
GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETV
KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTP
LPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSL
QMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDI
EKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF
PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKR
KAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGV
GVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRT
SSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN
QLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAV
MPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD
SFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNW
LPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYED
DFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSDFED
FDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIA
DCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVS
CAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK
AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALV
NNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEE
DIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEM
EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVP
NS
NT seq 5769 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgct
tcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataac
atttatacgccaagaaaatatcaggttgaactgcttgaagcagctctggatcataatacc
atcgtctgtttaaacactggctcagggaagacatttattgcagtactactcactaaagag
ctgtcctatcagatcaggggagacttcagcagaaatggaaaaaggacggtgttcttggtc
aactctgcaaaccaggttgctcaacaagtgtcagctgtcagaactcattcagatctcaag
gttggggaatactcaaacctagaagtaaatgcatcttggacaaaagagagatggaaccaa
gagtttactaagcaccaggttctcattatgacttgctatgtcgccttgaatgttttgaaa
aatggttacttatcactgtcagacattaaccttttggtgtttgatgagtgtcatcttgca
atcctagaccacccctatcgagaaattatgaagctctgtgaaaattgtccatcatgtcct
cgcattttgggactaactgcttccattttaaatgggaaatgtgatccagaggaattggaa
gaaaagattcagaaactagagaaaattcttaagagtaatgctgaaactgcaactgacctg
gtggtcttagacaggtatacttctcagccatgtgagattgtggtggattgtggaccattt
actgacagaagtgggctttatgaaagactgctgatggaattagaagaagcacttaatttt
atcaatgattgtaatatatctgtacattcaaaagaaagagattctactttaatttcgaaa
cagatactatcagactgtcgtgccgtattggtagttctgggaccctggtgtgcagataaa
gtagctggaatgatggtaagagaactacagaaatacatcaaacatgagcaagaggagctg
cacaggaaatttttattgtttacagacactttcctaaggaaaatacatgcactatgtgaa
gagcacttctcacctgcctcacttgacctgaaatttgtaactcctaaagtaatcaaactg
ctcgaaatcttacgcaaatataaaccatatgagcgacagcagtttgaaagcgttgagtgg
tataataatagaaatcaggataattatgtgtcatggagtgattctgaggatgatgatgag
gatgaagaaattgaagaaaaagagaagccagagacaaattttccttctccttttaccaac
attttgtgcggaattatttttgtggaaagaagatacacagcagttgtcttaaacagattg
ataaaggaagctggcaaacaagatccagagctggcttatatcagtagcaatttcataact
ggacatggcattgggaagaatcagcctcgcaacaaacagatggaagcagaattcagaaaa
caggaagaggtacttaggaaatttcgagcacatgagaccaacctgcttattgcaacaagt
attgtagaagagggtgttgatataccaaaatgcaacttggtggttcgttttgatttgccc
acagaatatcgatcctatgttcaatctaaaggaagagcaagggcacccatctctaattat
ataatgttagcggatacagacaaaataaaaagttttgaagaagaccttaaaacctacaaa
gctattgaaaagatcttgagaaacaagtgttccaagtcggttgatactggtgagactgac
attgatcctgtcatggatgatgatgacgttttcccaccatatgtgttgaggcctgacgat
ggtggtccacgagtcacaatcaacacggccattggacacatcaatagatactgtgctaga
ttaccaagtgatccgtttactcatctagctcctaaatgcagaacccgagagttgcctgat
ggtacattttattcaactctttatctgccaattaactcacctcttcgagcctccattgtt
ggtccaccaatgagctgtgtacgattggctgaaagagttgtagctctcatttgctgtgag
aaactgcacaaaattggcgaactggatgaccatttgatgccagttgggaaagagactgtt
aaatatgaagaggagcttgatttgcatgatgaagaagagaccagtgttccaggaagacca
ggttccacgaaacgaaggcagtgctacccaaaagcaattccagagtgtttgagggatagt
tatcccagacctgatcagccctgttacctgtatgtgataggaatggttttaactacacct
ttacctgatgaactcaactttagaaggcggaagctctatcctcctgaagataccacaaga
tgctttggaatactgacggccaaacccatacctcagattccacactttcctgtgtacaca
cgctctggagaggttaccatatccattgagttgaagaagtctggtttcatgttgtctcta
caaatgcttgagttgattacaagacttcaccagtatatattctcacatattcttcggctt
gaaaaacctgcactagaatttaaacctacagacgctgattcagcatactgtgttctacct
cttaatgttgttaatgactccagcactttggatattgactttaaattcatggaagatatt
gagaagtctgaagctcgcataggcattcccagtacaaagtatacaaaagaaacacccttt
gtttttaaattagaagattaccaagatgccgttatcattccaagatatcgcaattttgat
cagcctcatcgattttatgtagctgatgtgtacactgatcttaccccactcagtaaattt
ccttcccctgagtatgaaacttttgcagaatattataaaacaaagtacaaccttgaccta
accaatctcaaccagccactgctggatgtggaccacacatcttcaagacttaatcttttg
acacctcgacatttgaatcagaaggggaaagcgcttcctttaagcagtgctgagaagagg
aaagccaaatgggaaagtctgcagaataaacagatactggttccagaactctgtgctata
catccaattccagcatcactgtggagaaaagctgtttgtctccccagcatactttatcgc
cttcactgccttttgactgcagaggagctaagagcccagactgccagcgatgctggcgtg
ggagtcagatcacttcctgcggattttagataccctaacttagacttcgggtggaaaaaa
tctattgacagcaaatctttcatctcaatttctaactcctcttcagctgaaaatgataat
tactgtaagcacagcacaattgtccctgaaaatgctgcacatcaaggtgctaatagaacc
tcctctctagaaaatcatgaccaaatgtctgtgaactgcagaacgttgctcagcgagtcc
cctggtaagctccacgttgaagtttcagcagatcttacagcaattaatggtctttcttac
aatcaaaatctcgccaatggcagttatgatttagctaacagagacttttgccaaggaaat
cagctaaattactacaagcaggaaatacccgtgcaaccaactacctcatattccattcag
aatttatacagttacgagaaccagccccagcccagcgatgaatgtactctcctgagtaat
aaataccttgatggaaatgctaacaaatctacctcagatggaagtcctgtgatggccgta
atgcctggtacgacagacactattcaagtgctcaagggcaggatggattctgagcagagc
ccttctattgggtactcctcaaggactcttggccccaatcctggacttattcttcaggct
ttgactctgtcaaacgctagtgatggatttaacctggagcggcttgaaatgcttggcgac
tcctttttaaagcatgccatcaccacatatctattttgcacttaccctgatgcgcatgag
ggccgcctttcatatatgagaagcaaaaaggtcagcaactgtaatctgtatcgccttgga
aaaaagaagggactacccagccgcatggtggtgtcaatatttgatccccctgtgaattgg
cttcctcctggttatgtagtaaatcaagacaaaagcaacacagataaatgggaaaaagat
gaaatgacaaaagactgcatgctggcgaatggcaaactggatgaggattacgaggaggag
gatgaggaggaggagagcctgatgtggagggctccgaaggaagaggctgactatgaagat
gatttcctggagtatgatcaggaacatatcagatttatagataatatgttaatggggtca
ggagcttttgtaaagaaaatctctctttctcctttttcaaccactgattctgcatatgaa
tggaaaatgcccaaaaaatcctccttaggtagtatgccattttcatcagattttgaggat
tttgactacagctcttgggatgcaatgtgctatctggatcctagcaaagctgttgaagaa
gatgactttgtggtggggttctggaatccatcagaagaaaactgtggtgttgacacggga
aagcagtccatttcttacgacttgcacactgagcagtgtattgctgacaaaagcatagcg
gactgtgtggaagccctgctgggctgctatttaaccagctgtggggagagggctgctcag
cttttcctctgttcactggggctgaaggtgctcccggtaattaaaaggactgatcgggaa
aaggccctgtgccctactcgggagaatttcaacagccaacaaaagaacctttcagtgagc
tgtgctgctgcttctgtggccagttcacgctcttctgtattgaaagactcggaatatggt
tgtttgaagattccaccaagatgtatgtttgatcatccagatgcagataaaacactgaat
caccttatatcggggtttgaaaattttgaaaagaaaatcaactacagattcaagaataag
gcttaccttctccaggcttttacacatgcctcctaccactacaatactatcactgattgt
taccagcgcttagaattcctgggagatgcgattttggactacctcataaccaagcacctt
tatgaagacccgcggcagcactccccgggggtcctgacagacctgcggtctgccctggtc
aacaacaccatctttgcatcgctggctgtaaagtacgactaccacaagtacttcaaagct
gtctctcctgagctcttccatgtcattgatgactttgtgcagtttcagcttgagaagaat
gaaatgcaaggaatggattctgagcttaggagatctgaggaggatgaagagaaagaagag
gatattgaagttccaaaggccatgggggatatttttgagtcgcttgctggtgccatttac
atggatagtgggatgtcactggagacagtctggcaggtgtactatcccatgatgcggcca
ctaatagaaaagttttctgcaaatgtaccccgttcccctgtgcgagaattgcttgaaatg
gaaccagaaactgccaaatttagcccggctgagagaacttacgacgggaaggtcagagtc
actgtggaagtagtaggaaaggggaaatttaaaggtgttggtcgaagttacaggattgcc
aaatctgcagcagcaagaagagccctccgaagcctcaaagctaatcaacctcaggttccc
aatagctga

DBGET integrated database retrieval system