KEGG   Homo sapiens (human): 23411Help
Entry
23411             CDS       T01001                                 

Gene name
SIRT1, SIR2L1
Definition
sirtuin 1
Orthology
K11411  
NAD-dependent deacetylase sirtuin 1 [EC:3.5.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Amphetamine addiction
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:hsa05031]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q21.3
AA seq 452 aa AA seqDB search
MFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAG
IQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFG
ENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFD
VELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVS
EDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQM
ENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGA
EVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGA
GFGTDGDDQEAINEAISVKQEVTDMNYPSNKS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatattgaatatttcagaaaagatccaagaccattcttcaagtttgcaaaggaa
atatatcctggacaattccagccatctctctgtcacaaattcatagccttgtcagataag
gaaggaaaactacttcgcaactatacccagaacatagacacgctggaacaggttgcggga
atccaaaggataattcagtgtcatggttcctttgcaacagcatcttgcctgatttgtaaa
tacaaagttgactgtgaagctgtacgaggagatatttttaatcaggtagttcctcgatgt
cctaggtgcccagctgatgaaccgcttgctatcatgaaaccagagattgtgttttttggt
gaaaatttaccagaacagtttcatagagccatgaagtatgacaaagatgaagttgacctc
ctcattgttattgggtcttccctcaaagtaagaccagtagcactaattccaagttccata
ccccatgaagtgcctcagatattaattaatagagaacctttgcctcatctgcattttgat
gtagagcttcttggagactgtgatgtcataattaatgaattgtgtcataggttaggtggt
gaatatgccaaactttgctgtaaccctgtaaagctttcagaaattactgaaaaacctcca
cgaacacaaaaagaattggcttatttgtcagagttgccacccacacctcttcatgtttca
gaagactcaagttcaccagaaagaacttcaccaccagattcttcagtgattgtcacactt
ttagaccaagcagctaagagtaatgatgatttagatgtgtctgaatcaaaaggttgtatg
gaagaaaaaccacaggaagtacaaacttctaggaatgttgaaagtattgctgaacagatg
gaaaatccggatttgaagaatgttggttctagtactggggagaaaaatgaaagaacttca
gtggctggaacagtgagaaaatgctggcctaatagagtggcaaaggagcagattagtagg
cggcttgatggtaatcagtatctgtttttgccaccaaatcgttacattttccatggcgct
gaggtatattcagactctgaagatgacgtcttatcctctagttcttgtggcagtaacagt
gatagtgggacatgccagagtccaagtttagaagaacccatggaggatgaaagtgaaatt
gaagaattctacaatggcttagaagatgagcctgatgttccagagagagctggaggagct
ggatttgggactgatggagatgatcaagaggcaattaatgaagctatatctgtgaaacag
gaagtaacagacatgaactatccatcaaacaaatcatag

DBGET integrated database retrieval system