KEGG   Homo sapiens (human): 23411Help
Entry
23411             CDS       T01001                                 

Gene name
SIRT1, SIR2, SIR2L1, SIR2alpha
Definition
(RefSeq) sirtuin 1
  KO
K11411  
NAD-dependent deacetylase sirtuin 1 [EC:3.5.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Glucagon signaling pathway
Amphetamine addiction
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    23411 (SIRT1)
   04152 AMPK signaling pathway
    23411 (SIRT1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    23411 (SIRT1)
  Aging
   04211 Longevity regulating pathway - mammal
    23411 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    23411 (SIRT1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    23411 (SIRT1)
  Substance dependence
   05031 Amphetamine addiction
    23411 (SIRT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     23411 (SIRT1)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     23411 (SIRT1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    23411 (SIRT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q21.3
AA seq 747 aa AA seqDB search
MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggcggccctcgcccttcagcccggcggctccccctcggcggcgggggcc
gacagggaggccgcgtcgtcccccgccggggagccgctccgcaagaggccgcggagagat
ggtcccggcctcgagcggagcccgggcgagcccggtggggcggccccagagcgtgaggtg
ccggcggcggccaggggctgcccgggtgcggcggcggcggcgctgtggcgggaggcggag
gcagaggcggcggcggcaggcggggagcaagaggcccaggcgactgcggcggctggggaa
ggagacaatgggccgggcctgcagggcccatctcgggagccaccgctggccgacaacttg
tacgacgaagacgacgacgacgagggcgaggaggaggaagaggcggcggcggcggcgatt
gggtaccgagataaccttctgttcggtgatgaaattatcactaatggttttcattcctgt
gaaagtgatgaggaggatagagcctcacatgcaagctctagtgactggactccaaggcca
cggataggtccatatacttttgttcagcaacatcttatgattggcacagatcctcgaaca
attcttaaagatttattgccggaaacaatacctccacctgagttggatgatatgacactg
tggcagattgttattaatatcctttcagaaccaccaaaaaggaaaaaaagaaaagatatt
aatacaattgaagatgctgtgaaattactgcaagagtgcaaaaaaattatagttctaact
ggagctggggtgtctgtttcatgtggaatacctgacttcaggtcaagggatggtatttat
gctcgccttgctgtagacttcccagatcttccagatcctcaagcgatgtttgatattgaa
tatttcagaaaagatccaagaccattcttcaagtttgcaaaggaaatatatcctggacaa
ttccagccatctctctgtcacaaattcatagccttgtcagataaggaaggaaaactactt
cgcaactatacccagaacatagacacgctggaacaggttgcgggaatccaaaggataatt
cagtgtcatggttcctttgcaacagcatcttgcctgatttgtaaatacaaagttgactgt
gaagctgtacgaggagatatttttaatcaggtagttcctcgatgtcctaggtgcccagct
gatgaaccgcttgctatcatgaaaccagagattgtgttttttggtgaaaatttaccagaa
cagtttcatagagccatgaagtatgacaaagatgaagttgacctcctcattgttattggg
tcttccctcaaagtaagaccagtagcactaattccaagttccataccccatgaagtgcct
cagatattaattaatagagaacctttgcctcatctgcattttgatgtagagcttcttgga
gactgtgatgtcataattaatgaattgtgtcataggttaggtggtgaatatgccaaactt
tgctgtaaccctgtaaagctttcagaaattactgaaaaacctccacgaacacaaaaagaa
ttggcttatttgtcagagttgccacccacacctcttcatgtttcagaagactcaagttca
ccagaaagaacttcaccaccagattcttcagtgattgtcacacttttagaccaagcagct
aagagtaatgatgatttagatgtgtctgaatcaaaaggttgtatggaagaaaaaccacag
gaagtacaaacttctaggaatgttgaaagtattgctgaacagatggaaaatccggatttg
aagaatgttggttctagtactggggagaaaaatgaaagaacttcagtggctggaacagtg
agaaaatgctggcctaatagagtggcaaaggagcagattagtaggcggcttgatggtaat
cagtatctgtttttgccaccaaatcgttacattttccatggcgctgaggtatattcagac
tctgaagatgacgtcttatcctctagttcttgtggcagtaacagtgatagtgggacatgc
cagagtccaagtttagaagaacccatggaggatgaaagtgaaattgaagaattctacaat
ggcttagaagatgagcctgatgttccagagagagctggaggagctggatttgggactgat
ggagatgatcaagaggcaattaatgaagctatatctgtgaaacaggaagtaacagacatg
aactatccatcaaacaaatcatag

DBGET integrated database retrieval system