KEGG   Homo sapiens (human): 23411Help
Entry
23411             CDS       T01001                                 

Gene name
SIRT1, SIR2, SIR2L1, SIR2alpha
Definition
(RefSeq) sirtuin 1
  KO
K11411  NAD-dependent deacetylase sirtuin 1 [EC:3.5.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04922  Glucagon signaling pathway
hsa05031  Amphetamine addiction
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    23411 (SIRT1)
   04152 AMPK signaling pathway
    23411 (SIRT1)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    23411 (SIRT1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    23411 (SIRT1)
  Aging
   04211 Longevity regulating pathway - mammal
    23411 (SIRT1)
   04213 Longevity regulating pathway - multiple species
    23411 (SIRT1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    23411 (SIRT1)
  Substance dependence
   05031 Amphetamine addiction
    23411 (SIRT1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     23411 (SIRT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     23411 (SIRT1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    23411 (SIRT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 DUF592
Motif
Other DBs
NCBI-GeneID: 23411
NCBI-ProteinID: NP_036370
OMIM: 604479
HGNC: 14929
Ensembl: ENSG00000096717
Vega: OTTHUMG00000018340
Pharos: Q96EB6(Tchem)
UniProt: Q96EB6 A0A024QZQ1
Structure
PDB: 

Jmol
Position
10q21.3
AA seq 747 aa AA seqDB search
MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
GDDQEAINEAISVKQEVTDMNYPSNKS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggcggccctcgcccttcagcccggcggctccccctcggcggcgggggcc
gacagggaggccgcgtcgtcccccgccggggagccgctccgcaagaggccgcggagagat
ggtcccggcctcgagcggagcccgggcgagcccggtggggcggccccagagcgtgaggtg
ccggcggcggccaggggctgcccgggtgcggcggcggcggcgctgtggcgggaggcggag
gcagaggcggcggcggcaggcggggagcaagaggcccaggcgactgcggcggctggggaa
ggagacaatgggccgggcctgcagggcccatctcgggagccaccgctggccgacaacttg
tacgacgaagacgacgacgacgagggcgaggaggaggaagaggcggcggcggcggcgatt
gggtaccgagataaccttctgttcggtgatgaaattatcactaatggttttcattcctgt
gaaagtgatgaggaggatagagcctcacatgcaagctctagtgactggactccaaggcca
cggataggtccatatacttttgttcagcaacatcttatgattggcacagatcctcgaaca
attcttaaagatttattgccggaaacaatacctccacctgagttggatgatatgacactg
tggcagattgttattaatatcctttcagaaccaccaaaaaggaaaaaaagaaaagatatt
aatacaattgaagatgctgtgaaattactgcaagagtgcaaaaaaattatagttctaact
ggagctggggtgtctgtttcatgtggaatacctgacttcaggtcaagggatggtatttat
gctcgccttgctgtagacttcccagatcttccagatcctcaagcgatgtttgatattgaa
tatttcagaaaagatccaagaccattcttcaagtttgcaaaggaaatatatcctggacaa
ttccagccatctctctgtcacaaattcatagccttgtcagataaggaaggaaaactactt
cgcaactatacccagaacatagacacgctggaacaggttgcgggaatccaaaggataatt
cagtgtcatggttcctttgcaacagcatcttgcctgatttgtaaatacaaagttgactgt
gaagctgtacgaggagatatttttaatcaggtagttcctcgatgtcctaggtgcccagct
gatgaaccgcttgctatcatgaaaccagagattgtgttttttggtgaaaatttaccagaa
cagtttcatagagccatgaagtatgacaaagatgaagttgacctcctcattgttattggg
tcttccctcaaagtaagaccagtagcactaattccaagttccataccccatgaagtgcct
cagatattaattaatagagaacctttgcctcatctgcattttgatgtagagcttcttgga
gactgtgatgtcataattaatgaattgtgtcataggttaggtggtgaatatgccaaactt
tgctgtaaccctgtaaagctttcagaaattactgaaaaacctccacgaacacaaaaagaa
ttggcttatttgtcagagttgccacccacacctcttcatgtttcagaagactcaagttca
ccagaaagaacttcaccaccagattcttcagtgattgtcacacttttagaccaagcagct
aagagtaatgatgatttagatgtgtctgaatcaaaaggttgtatggaagaaaaaccacag
gaagtacaaacttctaggaatgttgaaagtattgctgaacagatggaaaatccggatttg
aagaatgttggttctagtactggggagaaaaatgaaagaacttcagtggctggaacagtg
agaaaatgctggcctaatagagtggcaaaggagcagattagtaggcggcttgatggtaat
cagtatctgtttttgccaccaaatcgttacattttccatggcgctgaggtatattcagac
tctgaagatgacgtcttatcctctagttcttgtggcagtaacagtgatagtgggacatgc
cagagtccaagtttagaagaacccatggaggatgaaagtgaaattgaagaattctacaat
ggcttagaagatgagcctgatgttccagagagagctggaggagctggatttgggactgat
ggagatgatcaagaggcaattaatgaagctatatctgtgaaacaggaagtaacagacatg
aactatccatcaaacaaatcatag

DBGET integrated database retrieval system