KEGG   Homo sapiens (human): 23439Help
Entry
23439             CDS       T01001                                 

Gene name
ATP1B4
Definition
(RefSeq) ATPase Na+/K+ transporting family member beta 4
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04911  Insulin secretion
hsa04918  Thyroid hormone synthesis
hsa04919  Thyroid hormone signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04960  Aldosterone-regulated sodium reabsorption
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04964  Proximal tubule bicarbonate reclamation
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04973  Carbohydrate digestion and absorption
hsa04974  Protein digestion and absorption
hsa04976  Bile secretion
hsa04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    23439 (ATP1B4)
   04022 cGMP - PKG signaling pathway
    23439 (ATP1B4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    23439 (ATP1B4)
   04918 Thyroid hormone synthesis
    23439 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    23439 (ATP1B4)
   04925 Aldosterone synthesis and secretion
    23439 (ATP1B4)
  Circulatory system
   04260 Cardiac muscle contraction
    23439 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    23439 (ATP1B4)
  Digestive system
   04970 Salivary secretion
    23439 (ATP1B4)
   04971 Gastric acid secretion
    23439 (ATP1B4)
   04972 Pancreatic secretion
    23439 (ATP1B4)
   04976 Bile secretion
    23439 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    23439 (ATP1B4)
   04974 Protein digestion and absorption
    23439 (ATP1B4)
   04978 Mineral absorption
    23439 (ATP1B4)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    23439 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    23439 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    23439 (ATP1B4)
CD molecules [BR:hsa04090]
 Proteins
  23439 (ATP1B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_K-ATPase Gcd10p
Motif
Other DBs
NCBI-GeneID: 23439
NCBI-ProteinID: NP_001135919
HGNC: 808
Ensembl: ENSG00000101892
Vega: OTTHUMG00000022299
Pharos: Q9UN42(Tdark)
UniProt: Q9UN42
Position
Xq24
AA seq 357 aa AA seqDB search
MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEK
EEEEEEEKEEEEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFY
ASLAAVITLCMYTLFLTISPYIPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVI
SLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGY
STGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYG
KLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLNIET
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggcaactccggtccagaagggctccatcctttccttacagttatcgctacaga
ctcgatgatccggatgaagcgaaccagaactacttagcagatgaagaggaggaagcagaa
gaagaggctcgggtgacggtggtgcccaaatcggaggaggaggaagaagaggaggagaaa
gaagaggaggaagaggaggaaaaggaggaggaagagggtcaaggtcagccaacaggcaat
gcctggtggcagaaattgcagatcatgagtgaatacctgtgggatccagagagaaggatg
tttctggcccgaacaggtcagagttggagcctgatcttactcatttacttcttcttctat
gcctccttggctgctgtgatcaccctctgcatgtacacactatttctgaccatcagtccc
tatataccaaccttcacggagcgggtaaagcctcctggagttatgatcagacccttcgcc
catagccttaacttcaacttcaacgtttctgaacccgacacttggcagcattatgtgatt
agcctaaatggctttctccagggttataatgacagtcttcaagaggaaatgaatgtagat
tgtcccccggggcagtacttcatccaagatggcaatgaggatgaggacaagaaggcctgc
caatttaagcgctccttcctaaagaactgctctggtctggaggacccaacttttggatac
tctactggacagccctgcatccttctaaagatgaaccggattgtaggctttcgtcctgag
cttggagatcctgtgaaggtttcctgcaaagttcagagaggtgatgaaaatgacatccga
tccatcagttactacccagagtcggcttcttttgacctccgctactacccttactacggc
aaactgactcacgttaactacacatcccccttggtggcaatgcactttacagacgtggtg
aagaaccaagcagtgcctgtgcagtgccaactgaagggcaaaggcgtcataaatgatgtc
atcaatgatcgttttgtgggcagggtaatctttaccctgaacatagaaacttaa

DBGET integrated database retrieval system