KEGG   Homo sapiens (human): 23439Help
Entry
23439             CDS       T01001                                 

Gene name
ATP1B4
Definition
ATPase, Na+/K+ transporting, beta 4 polypeptide
Orthology
K01540  
sodium/potassium-transporting ATPase subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Insulin secretion
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Aldosterone-regulated sodium reabsorption
Endocrine and other factor-regulated calcium reabsorption
Proximal tubule bicarbonate reclamation
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Carbohydrate digestion and absorption
Protein digestion and absorption
Bile secretion
Mineral absorption
Drug target
Acetyldigitoxin: 
Acetyldigoxin: 
Digitoxin: 
Digoxin: 
Lanatoside C: 
Deslanoside: 
Metildigoxin: 
Gitoformate: 
Proscillaridin: 
G-strophanthin: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    23439 (ATP1B4)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    23439 (ATP1B4)
   04918 Thyroid hormone synthesis
    23439 (ATP1B4)
   04919 Thyroid hormone signaling pathway
    23439 (ATP1B4)
  Circulatory system
   04260 Cardiac muscle contraction
    23439 (ATP1B4)
   04261 Adrenergic signaling in cardiomyocytes
    23439 (ATP1B4)
  Digestive system
   04970 Salivary secretion
    23439 (ATP1B4)
   04971 Gastric acid secretion
    23439 (ATP1B4)
   04972 Pancreatic secretion
    23439 (ATP1B4)
   04976 Bile secretion
    23439 (ATP1B4)
   04973 Carbohydrate digestion and absorption
    23439 (ATP1B4)
   04974 Protein digestion and absorption
    23439 (ATP1B4)
   04978 Mineral absorption
    23439 (ATP1B4)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    23439 (ATP1B4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    23439 (ATP1B4)
   04964 Proximal tubule bicarbonate reclamation
    23439 (ATP1B4)
Cellular antigens [BR:hsa04090]
 Proteins
  23439 (ATP1B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq24
AA seq 357 aa AA seqDB search
MRRQLRSRRAPSFPYSYRYRLDDPDEANQNYLADEEEEAEEEARVTVVPKSEEEEEEEEK
EEEEEEEKEEEEGQGQPTGNAWWQKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFY
ASLAAVITLCMYTLFLTISPYIPTFTERVKPPGVMIRPFAHSLNFNFNVSEPDTWQHYVI
SLNGFLQGYNDSLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGY
STGQPCILLKMNRIVGFRPELGDPVKVSCKVQRGDENDIRSISYYPESASFDLRYYPYYG
KLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVINDRFVGRVIFTLNIET
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggcaactccggtccagaagggctccatcctttccttacagttatcgctacaga
ctcgatgatccggatgaagcgaaccagaactacttagcagatgaagaggaggaagcagaa
gaagaggctcgggtgacggtggtgcccaaatcggaggaggaggaagaagaggaggagaaa
gaagaggaggaagaggaggaaaaggaggaggaagagggtcaaggtcagccaacaggcaat
gcctggtggcagaaattgcagatcatgagtgaatacctgtgggatccagagagaaggatg
tttctggcccgaacaggtcagagttggagcctgatcttactcatttacttcttcttctat
gcctccttggctgctgtgatcaccctctgcatgtacacactatttctgaccatcagtccc
tatataccaaccttcacggagcgggtaaagcctcctggagttatgatcagacccttcgcc
catagccttaacttcaacttcaacgtttctgaacccgacacttggcagcattatgtgatt
agcctaaatggctttctccagggttataatgacagtcttcaagaggaaatgaatgtagat
tgtcccccggggcagtacttcatccaagatggcaatgaggatgaggacaagaaggcctgc
caatttaagcgctccttcctaaagaactgctctggtctggaggacccaacttttggatac
tctactggacagccctgcatccttctaaagatgaaccggattgtaggctttcgtcctgag
cttggagatcctgtgaaggtttcctgcaaagttcagagaggtgatgaaaatgacatccga
tccatcagttactacccagagtcggcttcttttgacctccgctactacccttactacggc
aaactgactcacgttaactacacatcccccttggtggcaatgcactttacagacgtggtg
aagaaccaagcagtgcctgtgcagtgccaactgaagggcaaaggcgtcataaatgatgtc
atcaatgatcgttttgtgggcagggtaatctttaccctgaacatagaaacttaa

DBGET integrated database retrieval system