KEGG   Homo sapiens (human): 23517Help
Entry
23517             CDS       T01001                                 

Gene name
SKIV2L2, Dob1, KIAA0052, Mtr4, fSAP118
Definition
superkiller viralicidic activity 2-like 2 (S. cerevisiae) (EC:3.6.4.13)
Orthology
K12598  
ATP-dependent RNA helicase DOB1 [EC:3.6.4.13]
Organism
hsa  Homo sapiens (human)
Pathway
RNA degradation
Module
TRAMP complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    23517 (SKIV2L2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     23517 (SKIV2L2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    TRAMP complex
     23517 (SKIV2L2)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    23517 (SKIV2L2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    23517 (SKIV2L2)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA degradation factors
   TRAMP complex
    23517 (SKIV2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q11.2
AA seq 1042 aa AA seqDB search
MADAFGDELFSVFEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNG
KNKRDVDFEGTDEPIFGKKPRIEESITEDLSLADLMPRVKVQSVETVEGCTHEVALPAEE
DYLPLKPRVGKAAKEYPFILDAFQREAIQCVDNNQSVLVSAHTSAGKTVCAEYAIALALR
EKQRVIFTSPIKALSNQKYREMYEEFQDVGLMTGDVTINPTASCLVMTTEILRSMLYRGS
EVMREVAWVIFDEIHYMRDSERGVVWEETIILLPDNVHYVFLSATIPNARQFAEWICHLH
KQPCHVIYTDYRPTPLQHYIFPAGGDGLHLVVDENGDFREDNFNTAMQVLRDAGDLAKGD
QKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTKLDFNTDEEKKMV
EEVFSNAIDCLSDEDKKLPQVEHVLPLLKRGIGIHHGGLLPILKETIEILFSEGLIKALF
ATETFAMGINMPARTVLFTNARKFDGKDFRWISSGEYIQMSGRAGRRGMDDRGIVILMVD
EKMSPTIGKQLLKGSADPLNSAFHLTYNMVLNLLRVEEINPEYMLEKSFYQFQHYRAIPG
VVEKVKNSEEQYNKIVIPNEESVVIYYKIRQQLAKLGKEIEEYIHKPKYCLPFLQPGRLV
KVKNEGDDFGWGVVVNFSKKSNVKPNSGELDPLYVVEVLLRCSKESLKNSATEAAKPAKP
DEKGEMQVVPVLVHLLSAISSVRLYIPKDLRPVDNRQSVLKSIQEVQKRFPDGIPLLDPI
DDMGIQDQGLKKVIQKVEAFEHRMYSHPLHNDPNLETVYTLCEKKAQIAIDIKSAKRELK
KARTVLQMDELKCRKRVLRRLGFATSSDVIEMKGRVACEISSADELLLTEMMFNGLFNDL
SAEQATALLSCFVFQENSSEMPKLTEQLAGPLRQMQECAKRIAKVSAEAKLEIDEETYLS
SFKPHLMDVVYTWATGATFAHICKMTDVFEGSIIRCMRRLEELLRQMCQAAKAIGNTELE
NKFAEGITKIKRDIVFAASLYL
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcattcggagatgagctgttcagcgtgttcgagggcgactcgaccactgcg
gcgggaaccaaaaaagacaaggaaaaggacaaggggaaatggaaggggcctccagggtct
gcagacaaggcagggaaacgttttgatggtaaattacaatcagaatcaactaataatgga
aaaaataagagagatgtagatttcgaaggtacagatgaacccatttttggaaagaagccc
aggatagaagagtcaataactgaagacttaagtttggcagacctgatgcccagagtcaag
gtacaatcagttgaaactgttgaagggtgtacacatgaggttgcacttcctgcagaagag
gattatttaccacttaaaccacgagttggaaaagctgctaaggaatacccgttcattctt
gatgcttttcaaagagaggccattcagtgtgttgacaataatcagtctgttctagtatct
gcacatacctcagcgggaaaaacagtatgcgccgagtatgccattgcattggccttaagg
gaaaagcagcgtgtaatatttaccagcccaattaaggctctgagtaaccaaaaataccgt
gaaatgtatgaagaatttcaagatgttggtttgatgactggtgatgttactattaatcct
acggcatcttgtcttgttatgaccacagagattttgagaagtatgctttacagaggttcc
gaagttatgagagaagttgcttgggttatatttgatgaaattcattatatgagagattca
gaacgtggtgtagtatgggaagaaactattattttgcttcctgataacgtccactatgtc
tttctttcggctactattccaaatgcccgacagtttgctgaatggatttgccatttacat
aaacagccttgtcatgttatttacacagattatcggcccactccattgcaacactacatt
tttccagcagggggagatggcctgcatcttgtggttgatgaaaatggtgacttcagagaa
gataattttaatactgcaatgcaagtgcttcgagatgcaggtgatttggccaaaggagac
cagaaagggcggaaaggaggaacaaaaggaccatcaaatgttttcaaaattgtgaagatg
attatggaaagaaatttccaacctgtgattattttcagttttagtaagaaagattgtgaa
gcctatgcacttcaaatgaccaaattagatttcaacacagatgaagaaaagaagatggtt
gaagaagtattcagtaatgcaattgattgcttatccgatgaagataaaaaactccctcag
gtagaacatgtacttcctcttttgaagaggggaattggtattcaccatggtggtttactt
cctattttgaaagaaactatagaaattctcttttctgaaggattgataaaggccttattt
gccacggagacctttgctatgggaattaacatgccagctagaactgttttatttacaaat
gcccgcaaatttgatgggaaggatttccgatggatttcttctggtgaatacattcagatg
tctggtcgtgctggaaggagaggaatggatgatagaggaattgtaattcttatggtagat
gaaaagatgagcccaacaattggaaaacaattacttaagggctccgctgatcctctaaat
agtgctttccatttgacctacaacatggttttgaacttactacgtgtagaagaaattaat
cctgagtacatgttggaaaaatccttctaccagtttcagcattatagagcaattccagga
gtagtagagaaggtaaagaattcagaagaacagtataataaaatagtaattcccaatgaa
gaaagtgtggttatctattataagattagacagcagcttgccaaattgggtaaagaaatt
gaagaatatattcacaaaccaaaatactgcttaccttttctacaaccaggtcgtttggta
aaggtaaagaatgaaggagatgactttggctggggagtagtggtgaatttctcaaaaaag
tcaaatgttaagcctaactctggtgaactggatcctttgtatgtagtagaagtacttctg
cgctgtagcaaagagagcttgaaaaattcagctacagaagctgcaaaaccagctaaacct
gatgagaaaggagagatgcaggttgtcccagttttggtgcatctcctgtctgctatcagc
agtgttaggctttacattcctaaagaccttcggccggtggacaatagacagagtgtttta
aaatcaatacaggaagttcagaaacgttttcctgacggcatccccttattagaccctatt
gatgatatgggcattcaagatcaagggctgaaaaaagtcattcagaaagtagaagctttt
gagcatcgaatgtattctcatccacttcacaatgatccaaatttggaaactgtgtatacg
ctttgtgaaaaaaaagcacagattgcaatagatattaaatctgcaaagcgagaactgaag
aaagcaagaacagtcctacaaatggatgaactcaaatgtcgcaaacgtgttttaagaagg
ttgggatttgctacttcttctgatgtaatagagatgaaaggacgagtggcttgtgagata
agcagtgctgatgagctccttctaactgagatgatgtttaatggccttttcaatgacctt
tctgcagaacaggcaacagcattattaagctgctttgtgtttcaagagaattctagtgag
atgcccaaattaacagaacaattagcaggaccacttcgtcaaatgcaggaatgtgctaaa
agaattgcaaaagtttcagcagaagccaaattggaaattgatgaggaaacttatctaagc
tcatttaaacctcacttaatggatgtagtatatacctgggcaactggagctacatttgcc
catatctgcaaaatgacagatgtctttgaaggcagcataattcgttgtatgaggcgcctg
gaagaattgcttcgacaaatgtgtcaagcagcaaaagccattggaaacactgagctggaa
aataaatttgcagaaggaatcaccaaaatcaagagagatattgtgtttgctgccagcctc
tacttgtag

DBGET integrated database retrieval system