KEGG   Homo sapiens (human): 2353Help
Entry
2353              CDS       T01001                                 

Gene name
FOS, AP-1, C-FOS, p55
Definition
FBJ murine osteosarcoma viral oncogene homolog
Orthology
K04379  
proto-oncogene protein c-fos
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
cAMP signaling pathway
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
TNF signaling pathway
Circadian entrainment
Cholinergic synapse
Dopaminergic synapse
Estrogen signaling pathway
Prolactin signaling pathway
Oxytocin signaling pathway
Amphetamine addiction
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Hepatitis B
HTLV-I infection
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2353 (FOS)
   04668 TNF signaling pathway
    2353 (FOS)
   04024 cAMP signaling pathway
    2353 (FOS)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    2353 (FOS)
   04660 T cell receptor signaling pathway
    2353 (FOS)
   04662 B cell receptor signaling pathway
    2353 (FOS)
  Endocrine system
   04915 Estrogen signaling pathway
    2353 (FOS)
   04917 Prolactin signaling pathway
    2353 (FOS)
   04921 Oxytocin signaling pathway
    2353 (FOS)
  Nervous system
   04725 Cholinergic synapse
    2353 (FOS)
   04728 Dopaminergic synapse
    2353 (FOS)
  Development
   04380 Osteoclast differentiation
    2353 (FOS)
  Environmental adaptation
   04713 Circadian entrainment
    2353 (FOS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2353 (FOS)
   05210 Colorectal cancer
    2353 (FOS)
  Immune diseases
   05323 Rheumatoid arthritis
    2353 (FOS)
  Substance dependence
   05031 Amphetamine addiction
    2353 (FOS)
  Infectious diseases
   05132 Salmonella infection
    2353 (FOS)
   05133 Pertussis
    2353 (FOS)
   05166 HTLV-I infection
    2353 (FOS)
   05161 Hepatitis B
    2353 (FOS)
   05168 Herpes simplex infection
    2353 (FOS)
   05140 Leishmaniasis
    2353 (FOS)
   05142 Chagas disease (American trypanosomiasis)
    2353 (FOS)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2353 (FOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
14q24.3
AA seq 380 aa AA seqDB search
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg
tccccggccggggatagcctctcttactaccactcacccgcagactccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcccgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccgcc
ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg
cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggttgccaccccggagtctgaggaggccttcacc
ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc
agcatggagctgaagaccgagccctttgatgacttcctgttcccagcatcatccaggccc
agtggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcctctgcacagtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcagctgcccaccgcaag
ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggccctg
tga

DBGET integrated database retrieval system