KEGG   Homo sapiens (human): 2357Help
Entry
2357              CDS       T01001                                 

Gene name
FPR1, FMLP, FPR
Definition
(RefSeq) formyl peptide receptor 1
  KO
K04172  
formyl peptide receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Neuroactive ligand-receptor interaction
Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    2357 (FPR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2357 (FPR1)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    2357 (FPR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   fMet-Leu-Phe
    2357 (FPR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
19q13.4
AA seq 350 aa AA seqDB search
METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVT
TISYLNLAVADFCFTSTLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIA
LDRCVCVLHPVWTQNHRTVSLAKKVIIGPWVMALLLTLPVIIRVTTVPGKTGTVACTFNF
SPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIATKIHKQGLIKSSRPL
RVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML
YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaattcctctctccccacgaacatctctggagggacacctgctgtatctgct
ggctatctcttcctggatatcatcacttatctggtatttgcagtcacctttgtcctcggg
gtcctgggcaacgggcttgtgatctgggtggctggattccggatgacacacacagtcacc
accatcagttacctgaacctggccgtggctgacttctgtttcacctccactttgccattc
ttcatggtcaggaaggccatgggaggacattggcctttcggctggttcctgtgcaaattc
gtctttaccatagtggacatcaacttgttcggaagtgtcttcctgatcgccctcattgct
ctggaccgctgtgtttgcgtcctgcatccagtctggacccagaaccaccgcaccgtgagc
ctggccaagaaggtgatcattgggccctgggtgatggctctgctcctcacattgccagtt
atcattcgtgtgactacagtacctggtaaaacggggacagtagcctgcacttttaacttt
tcgccctggaccaacgaccctaaagagaggataaatgtggccgttgccatgttgacggtg
agaggcatcatccggttcatcattggcttcagcgcacccatgtccatcgttgctgtcagt
tatgggcttattgccaccaagatccacaagcaaggcttgattaagtccagtcgtccctta
cgggtcctctcctttgtcgcagcagccttttttctctgctggtccccatatcaggtggtg
gcccttatagccacagtcagaatccgtgagttattgcaaggcatgtacaaagaaattggt
attgcagtggatgtgacaagtgccctggccttcttcaacagctgcctcaaccccatgctc
tatgtcttcatgggccaggacttccgggagaggctgatccacgcccttcccgccagtctg
gagagggccctgaccgaggactcaacccaaaccagtgacacagctaccaattctacttta
ccttctgcagaggtggagttacaggcaaagtga

DBGET integrated database retrieval system