KEGG   Homo sapiens (human): 2358Help
Entry
2358              CDS       T01001                                 

Gene name
FPR2, ALXR, FMLP-R-II, FMLPX, FPR2A, FPRH1, FPRH2, FPRL1, HM63, LXA4R
Definition
formyl peptide receptor 2
Orthology
K04173  
formyl peptide receptor-like
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Staphylococcus aureus infection
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:hsa05150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.3-q13.4
AA seq 351 aa AA seqDB search
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVT
TICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIA
LDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNF
ASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPM
LYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaacttctccactcctctgaatgaatatgaagaagtgtcctatgagtctgct
ggctacactgttctgcggatcctcccattggtggtgcttggggtcacctttgtcctcggg
gtcctgggcaatgggcttgtgatctgggtggctggattccggatgacacgcacagtcacc
accatctgttacctgaacctggccctggctgacttttctttcacggccacattaccattc
ctcattgtctccatggccatgggagaaaaatggccttttggctggttcctgtgtaagtta
attcacatcgtggtggacatcaacctctttggaagtgtcttcttgattggtttcattgca
ctggaccgctgcatttgtgtcctgcatccagtctgggcccagaaccaccgcactgtgagt
ctggccatgaaggtgatcgtcggaccttggattcttgctctagtccttaccttgccagtt
ttcctctttttgactacagtaactattccaaatggggacacatactgtactttcaacttt
gcatcctggggtggcacccctgaggagaggctgaaggtggccattaccatgctgacagcc
agagggattatccggtttgtcattggctttagcttgccgatgtccattgttgccatctgc
tatgggctcattgcagccaagatccacaaaaagggcatgattaaatccagccgtccctta
cgggtcctcactgctgtggtggcttctttcttcatctgttggtttccctttcaactggtt
gcccttctgggcaccgtctggctcaaagagatgttgttctatggcaagtacaaaatcatt
gacatcctggttaacccaacgagctccctggccttcttcaacagctgcctcaaccccatg
ctttacgtctttgtgggccaagacttccgagagagactgatccactccctgcccaccagt
ctggagagggccctgtctgaggactcagccccaactaatgacacggctgccaattctgct
tcacctcctgcagagactgagttacaggcaatgtga

DBGET integrated database retrieval system