KEGG   Homo sapiens (human): 23592Help
Entry
23592             CDS       T01001                                 

Gene name
LEMD3, MAN1
Definition
(RefSeq) LEM domain containing 3
  KO
K19410  
inner nuclear membrane protein Man1
Organism
hsa  Homo sapiens (human)
Disease
H00452  
Disorders caused by loss-of-function of LEMD3
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14
AA seq 911 aa AA seqDB search
MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
NKTRNSNNNNTAAATVAAAGPAAAAAAGMGVRPVSGDLSYLRTPGGLCRISASGPESLLG
GPGGASAAPAAGSKVLLGFSSDESDVEASPRDQAGGGGRKDRASLQYRGLKAPPAPLAAS
EVTNSNSAERRKPHSWWGARRPAGPELQTPPGKDGAVEDEEGEGEDGEERDPETEEPLWA
SRTVNGSRLVPYSCRENYSDSEEEDDDDVASSRQVLKDDSLSRHRPRRTHSKPLPPLTAK
SAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEQGGGCDQVDSSPVPRYRVN
AKKLTPLLPPPLTDMDSTLDSSTGSLLKTNNHIGGGAFSVDSPRIYSNSLPPSAAVAASS
SLRINHANHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGSFSAHYLSMFLLTA
ACLFFLILGLTYLGMRGTGVSEDGELSIENPFGETFGKIQESEKTLMMNTLYKLHDRLAQ
LAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEGIFNTSLQWILENGKDVGIRCVGFGPEE
ELTNITDVQFLQSTRPLMSFWCRFRRAFVTVTHRLLLLCLGVVMVCVVLRYMKYRWTKEE
EETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAV
DFLAANESRVRTETRRIGGADFLVWRWIQPSASCDKILVIPSKVWQGQAFHLDRRNSPPN
SLTPCLKIRNMFDPVMEIGDQWHLAIQEAILEKCSDNDGIVHIAVDKNSREGCVYVKCLS
PEYAGKAFKALHGSWFDGKLVTVKYLRLDRYHHRFPQALTSNTPLKPSNKHMNSMSHLRL
RTGLTNSQGSS
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcagcttcggcgcctcagcagctctcggatgaggagcttttctctcag
ctccgccgttacggcctgtctcccggaccagtgacggagagcacccgcccggtctacctc
aagaagctgaagaagcttcgagaggaagagcagcaacagcaccggtcagggggccgcggc
aacaagacgcggaacagtaataacaataacacggcagccgccacggtcgcagccgcggga
ccagcggcggcggcggccgcggggatgggggtccggccggtctcgggcgacctctcctac
ttacggactcctgggggcctgtgccgaatctcggcctctggcccagagagcctcctggga
gggcccgggggcgcctccgccgcccccgcggctggcagcaaagtgctgctgggcttcagc
tcggacgagtcggacgtggaggccagtccccgggaccaggccggcggcggcgggaggaaa
gaccgggcttcgctccagtaccgcgggctcaaagcgccgccggcgcccctggccgccagc
gaggtgactaacagcaactctgcagagcgaaggaagccccactcgtggtggggggccagg
aggccggcgggccccgagctgcagaccccgccggggaaagatggagcagtggaggacgag
gaaggggagggagaggacggtgaggagagggacccggagaccgaggagccgctctgggcg
agccggaccgtgaatggcagccggcttgtcccctacagctgccgggaaaactattcggac
tcagaggaagaggacgacgacgacgtggcctccagcagacaggtattaaaggacgactcc
ctttcccggcatcggcccagacgaacccatagtaagcctctccccccgctgactgctaaa
tcggccggcggcaggctggagacttcagttcagggagggggaggactcgcgatgaatgac
agggcggcggctgccgggagtctagacaggagccgaaacctcgaagaggcggcggccgcg
gagcagggaggagggtgtgatcaagtggactccagccccgttcctagataccgtgttaac
gctaagaaactgacccctctcctgcccccgccacttactgacatggactcaaccttggat
tcgtcaacaggctcccttctgaaaaccaataatcatattggcggtggggccttcagtgtg
gactcccccaggatttattctaacagtctccctcccagtgcggcggtggccgcctctagt
tcactcaggatcaatcacgccaatcatacgggctccaatcatacctacctgaaaaacaca
tacaacaaaccgaagctttccgaacccgaagaggaacttctccagcaatttaaacgggag
gaggtgtccccaacagggagtttcagtgcccactacttgtcgatgtttctcttaactgct
gcctgcttatttttcctaatactgggactgacttacctaggaatgagagggacaggagta
tctgaggatggagaactcagcatagaaaacccctttggtgaaacatttggaaaaatacaa
gaaagtgaaaaaactcttatgatgaacacattatataagcttcatgatcgattggcacag
cttgcaggagatcatgaatgtggcagttctagtcaaagaacgctttctgttcaagaggca
gctgcgtatttaaaagatttaggtcctgaatatgaaggtatatttaacacttcattgcag
tggatcttagaaaatggaaaagatgttggaataaggtgtgttggttttggccctgaggaa
gaattgacaaatataactgatgtgcagtttttacagtccacaagaccactgatgtctttt
tggtgtcgttttcgacgtgcttttgttactgtaactcacagattattgttgttatgctta
ggtgtagtgatggtttgtgtcgttctgcgttacatgaaatatcgatggacaaaagaagag
gaggaaacaaggcagatgtatgatatggtggtaaagattatagatgttttacgaagtcat
aatgaagcctgccaggaaaacaaagatttacaaccttacatgcctattccacatgtacgc
gattccttaatacagcctcatgacaggaaaaaaatgaagaaagtctgggatagagctgtt
gacttccttgctgctaatgagtctagagttcgcacggaaacacgaagaataggtggtgca
gattttctggtttggcggtggatccagccttctgcatcctgtgacaaaatattagttata
ccttctaaagtatggcaaggtcaagcatttcatttagatagaagaaattcaccaccaaat
agtttgacaccgtgtctaaagattcggaatatgtttgatcccgttatggaaataggggat
cagtggcatttggcaattcaagaagcaattttagaaaaatgcagtgataatgatggcatt
gttcacattgcagtagacaaaaattcacgtgagggttgtgtatatgttaaatgtctgtct
ccagaatatgctggaaaggcttttaaagcattgcatggctcttggtttgatgggaaattg
gttacagtaaaatatttacgactagatagataccaccatcgctttccccaggctctcact
tccaacactccattgaagccatcaaataaacatatgaactccatgtctcatcttcgtctt
cggactggcctaaccaattctcaaggaagttcctga

DBGET integrated database retrieval system