KEGG   Homo sapiens (human): 23765Help
Entry
23765             CDS       T01001                                 

Gene name
IL17RA, CANDF5, CD217, CDw217, IL-17RA, IL17R, hIL-17R
Definition
interleukin 17 receptor A
Orthology
K05164  
interleukin 17 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Disease
H00363  
Candidiasis
H01109  
Chronic mucocutaneous candidiasis (CMC)
Drug target
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:hsa04060]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.1
AA seq 866 aa AA seqDB search
MGAARSPPSAVPGPLLGLLLLLLGVLAPGGASLRLLDHRALVCSQPGLNCTVKNSTCLDD
SWIHPRNLTPSSPKDLQIQLHFAHTQQGDLFPVAHIEWTLQTDASILYLEGAELSVLQLN
TNERLCVRFEFLSKLRHHHRRWRFTFSHFVVDPDQEYEVTVHHLPKPIPDGDPNHQSKNF
LVPDCEHARMKVTTPCMSSGSLWDPNITVETLEAHQLRVSFTLWNESTHYQILLTSFPHM
ENHSCFEHMHHIPAPRPEEFHQRSNVTLTLRNLKGCCRHQVQIQPFFSSCLNDCLRHSAT
VSCPEMPDTPEPIPDYMPLWVYWFITGISILLVGSVILLIVCMTWRLAGPGSEKYSDDTK
YTDGLPAADLIPPPLKPRKVWIIYSADHPLYVDVVLKFAQFLLTACGTEVALDLLEEQAI
SEAGVMTWVGRQKQEMVESNSKIIVLCSRGTRAKWQALLGRGAPVRLRCDHGKPVGDLFT
AAMNMILPDFKRPACFGTYVVCYFSEVSCDGDVPDLFGAAPRYPLMDRFEEVYFRIQDLE
MFQPGRMHRVGELSGDNYLRSPGGRQLRAALDRFRDWQVRCPDWFECENLYSADDQDAPS
LDEEVFEEPLLPPGTGIVKRAPLVREPGSQACLAIDPLVGEEGGAAVAKLEPHLQPRGQP
APQPLHTLVLAAEEGALVAAVEPGPLADGAAVRLALAGEGEACPLLGSPGAGRNSVLFLP
VDPEDSPLGSSTPMASPDLLPEDVREHLEGLMLSLFEQSLSCQAQGGCSRPAMVLTDPHT
PYEEEQRQSVQSDQGYISRSSPQPPEGLTEMEEEEEEEQDPGKPALPLSPEDLESLRSLQ
RQLLFRQLQKNSGWDTMGSESEGPSA
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcacgcagcccgccgtccgctgtcccggggcccctgctggggctgctcctg
ctgctcctgggcgtgctggccccgggtggcgcctccctgcgactcctggaccaccgggcg
ctggtctgctcccagccggggctaaactgcacggtcaagaatagtacctgcctggatgac
agctggattcaccctcgaaacctgaccccctcctccccaaaggacctgcagatccagctg
cactttgcccacacccaacaaggagacctgttccccgtggctcacatcgaatggacactg
cagacagacgccagcatcctgtacctcgagggtgcagagttatctgtcctgcagctgaac
accaatgaacgtttgtgcgtcaggtttgagtttctgtccaaactgaggcatcaccacagg
cggtggcgttttaccttcagccactttgtggttgaccctgaccaggaatatgaggtgacc
gttcaccacctgcccaagcccatccctgatggggacccaaaccaccagtccaagaatttc
cttgtgcctgactgtgagcacgccaggatgaaggtaaccacgccatgcatgagctcaggc
agcctgtgggaccccaacatcaccgtggagaccctggaggcccaccagctgcgtgtgagc
ttcaccctgtggaacgaatctacccattaccagatcctgctgaccagttttccgcacatg
gagaaccacagttgctttgagcacatgcaccacatacctgcgcccagaccagaagagttc
caccagcgatccaacgtcacactcactctacgcaaccttaaagggtgctgtcgccaccaa
gtgcagatccagcccttcttcagcagctgcctcaatgactgcctcagacactccgcgact
gtttcctgcccagaaatgccagacactccagaaccaattccggactacatgcccctgtgg
gtgtactggttcatcacgggcatctccatcctgctggtgggctccgtcatcctgctcatc
gtctgcatgacctggaggctagctgggcctggaagtgaaaaatacagtgatgacaccaaa
tacaccgatggcctgcctgcggctgacctgatccccccaccgctgaagcccaggaaggtc
tggatcatctactcagccgaccaccccctctacgtggacgtggtcctgaaattcgcccag
ttcctgctcaccgcctgcggcacggaagtggccctggacctgctggaagagcaggccatc
tcggaggcaggagtcatgacctgggtgggccgtcagaagcaggagatggtggagagcaac
tctaagatcatcgtcctgtgctcccgcggcacgcgcgccaagtggcaggcgctcctgggc
cggggggcgcctgtgcggctgcgctgcgaccacggaaagcccgtgggggacctgttcact
gcagccatgaacatgatcctcccggacttcaagaggccagcctgcttcggcacctacgta
gtctgctacttcagcgaggtcagctgtgacggcgacgtccccgacctgttcggcgcggcg
ccgcggtacccgctcatggacaggttcgaggaggtgtacttccgcatccaggacctggag
atgttccagccgggccgcatgcaccgcgtaggggagctgtcgggggacaactacctgcgg
agcccgggcggcaggcagctccgcgccgccctggacaggttccgggactggcaggtccgc
tgtcccgactggttcgaatgtgagaacctctactcagcagatgaccaggatgccccgtcc
ctggacgaagaggtgtttgaggagccactgctgcctccgggaaccggcatcgtgaagcgg
gcgcccctggtgcgcgagcctggctcccaggcctgcctggccatagacccgctggtcggg
gaggaaggaggagcagcagtggcaaagctggaacctcacctgcagccccggggtcagcca
gcgccgcagcccctccacaccctggtgctcgccgcagaggagggggccctggtggccgcg
gtggagcctgggcccctggctgacggtgccgcagtccggctggcactggcgggggagggc
gaggcctgcccgctgctgggcagcccgggcgctgggcgaaatagcgtcctcttcctcccc
gtggaccccgaggactcgccccttggcagcagcacccccatggcgtctcctgacctcctt
ccagaggacgtgagggagcacctcgaaggcttgatgctctcgctcttcgagcagagtctg
agctgccaggcccaggggggctgcagtagacccgccatggtcctcacagacccacacacg
ccctacgaggaggagcagcggcagtcagtgcagtctgaccagggctacatctccaggagc
tccccgcagccccccgagggactcacggaaatggaggaagaggaggaagaggagcaggac
ccagggaagccggccctgccactctctcccgaggacctggagagcctgaggagcctccag
cggcagctgcttttccgccagctgcagaagaactcgggctgggacacgatggggtcagag
tcagaggggcccagtgcatga

DBGET integrated database retrieval system