KEGG   Homo sapiens (human): 240Help
Entry
240               CDS       T01001                                 

Gene name
ALOX5, 5-LO, 5-LOX, 5LPG, LOG5
Definition
arachidonate 5-lipoxygenase (EC:1.13.11.34)
Orthology
K00461  
arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
hsa  Homo sapiens (human)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Ovarian steroidogenesis
Toxoplasmosis
Drug target
Benoxaprofen: 
Oxatomide: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    240 (ALOX5)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    240 (ALOX5)
  Nervous system
   04726 Serotonergic synapse
    240 (ALOX5)
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    240 (ALOX5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     240 (ALOX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q11.2
AA seq 674 aa AA seqDB search
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctacacggtcaccgtggccactggcagccagtggttcgccggcactgacgac
tacatctacctcagcctcgtgggctcggcgggctgcagcgagaagcacctgctggacaag
cccttctacaacgacttcgagcgtggcgcggtggattcatacgacgtgactgtggacgag
gaactgggcgagatccagctggtcagaatcgagaagcgcaagtactggctgaatgacgac
tggtacctgaagtacatcacgctgaagacgccccacggggactacatcgagttcccctgc
taccgctggatcaccggcgatgtcgaggttgtcctgagggatggacgcgcaaagttggcc
cgagatgaccaaattcacattctcaagcaacaccgacgtaaagaactggaaacacggcaa
aaacaatatcgatggatggagtggaaccctggcttccccttgagcatcgatgccaaatgc
cacaaggatttaccccgtgatatccagtttgatagtgaaaaaggagtggactttgttctg
aattactccaaagcgatggagaacctgttcatcaaccgcttcatgcacatgttccagtct
tcttggaatgacttcgccgactttgagaaaatctttgtcaagatcagcaacactatttct
gagcgggtcatgaatcactggcaggaagacctgatgtttggctaccagttcctgaatggc
tgcaaccctgtgttgatccggcgctgcacagagctgcccgagaagctcccggtgaccacg
gagatggtagagtgcagcctggagcggcagctcagcttggagcaggaggtccagcaaggg
aacattttcatcgtggactttgagctgctggatggcatcgatgccaacaaaacagacccc
tgcacactccagttcctggccgctcccatctgcttgctgtataagaacctggccaacaag
attgtccccattgccatccagctcaaccaaatcccgggagatgagaaccctattttcctc
ccttcggatgcaaaatacgactggcttttggccaaaatctgggtgcgttccagtgacttc
cacgtccaccagaccatcacccaccttctgcgaacacatctggtgtctgaggtttttggc
attgcaatgtaccgccagctgcctgctgtgcaccccattttcaagctgctggtggcacac
gtgagattcaccattgcaatcaacaccaaggcccgtgagcagctcatctgcgagtgtggc
ctctttgacaaggccaacgccacagggggcggtgggcacgtgcagatggtgcagagggcc
atgaaggacctgacctatgcctccctgtgctttcccgaggccatcaaggcccggggcatg
gagagcaaagaagacatcccctactacttctaccgggacgacgggctcctggtgtgggaa
gccatcaggacgttcacggccgaggtggtagacatctactacgagggcgaccaggtggtg
gaggaggacccggagctgcaggacttcgtgaacgatgtctacgtgtacggcatgcggggc
cgcaagtcctcaggcttccccaagtcggtcaagagccgggagcagctgtcggagtacctg
accgtggtgatcttcaccgcctccgcccagcacgccgcggtcaacttcggccagtacgac
tggtgctcctggatccccaatgcgcccccaaccatgcgagccccgccaccgactgccaag
ggcgtggtgaccattgagcagatcgtggacacgctgcccgaccgcggccgctcctgctgg
catctgggtgcagtgtgggcgctgagccagttccaggaaaacgagctgttcctgggcatg
tacccagaagagcattttatcgagaagcctgtgaaggaagccatggcccgattccgcaag
aacctcgaggccattgtcagcgtgattgctgagcgcaacaagaagaagcagctgccatat
tactacttgtccccagaccggattccgaacagtgtggccatctga

DBGET integrated database retrieval system